Junctional Adhesion Molecule C (JAM3) (NM_032801) Human Mass Spec Standard
CAT#: PH316073
JAM3 MS Standard C13 and N15-labeled recombinant protein (NP_116190)
View other "Junctional Adhesion Molecule C" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | JAM3 MS Standard C13 and N15-labeled recombinant protein (NP_116190) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC216073 |
Predicted MW | 36.5 kDa |
Protein Sequence |
>RC216073 representing NM_032801
Red=Cloning site Green=Tags(s) MVPARLGPAVAMVTGAGRRVLAGWAHARGDYKPRRAAAGPSATLDMALRRPPRLRLCARLPDFFLLLLFR GCLIGAVNLKSSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEIL GKTSLKIWNVTRRDSALYRCEVVARNDRKEIDEIVIELTVQVKPVTPVCRVPKAVPVGKMATLHCQESEG HPRPHYSWYRNDVPLPTDSRANPRFRNSSFHLNSETGTLVFTAVHKDDSGQYYCIASNDAGSARCEEQEM EVYDLNIGGIIGGVLVVLAVLALITLGICCAYRRGYFINNKQDGESYKNPGKPDGVNYIRTDEEGDFRHK SSFVI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_116190 |
RefSeq Size | 3675 |
RefSeq ORF | 1065 |
Synonyms | JAM-2; JAM-3; JAM-C; JAMC |
Locus ID | 83700 |
Cytogenetics | 11q25 |
Summary | Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. The protein encoded by this immunoglobulin superfamily gene member is localized in the tight junctions between high endothelial cells. Unlike other proteins in this family, the this protein is unable to adhere to leukocyte cell lines and only forms weak homotypic interactions. The encoded protein is a member of the junctional adhesion molecule protein family and acts as a receptor for another member of this family. A mutation in an intron of this gene is associated with hemorrhagic destruction of the brain, subependymal calcification, and congenital cataracts. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Apr 2011] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Cell adhesion molecules (CAMs), Epithelial cell signaling in Helicobacter pylori infection, Leukocyte transendothelial migration, Tight junction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403197 | JAM3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403197 | Transient overexpression lysate of junctional adhesion molecule 3 (JAM3) |
CNY 3,080.00 |
|
TP316073 | Recombinant protein of human junctional adhesion molecule 3 (JAM3), 20 µg |
CNY 2,900.00 |
其它Junctional Adhesion Molecule C产品