BHLHA15 (NM_177455) Human Mass Spec Standard
CAT#: PH315938
BHLHA15 MS Standard C13 and N15-labeled recombinant protein (NP_803238)
View other "BHLHA15" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | BHLHA15 MS Standard C13 and N15-labeled recombinant protein (NP_803238) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215938 |
Predicted MW | 20.6 kDa |
Protein Sequence |
>RC215938 representing NM_177455
Red=Cloning site Green=Tags(s) MKTKNRPPRRRAPVQDTEATPGEGTPDGSLPNPGPEPAKGLRSRPARAAARAPGEGRRRRPGPSGPGGRR DSSIQRRLESNERERQRMHKLNNAFQALREVIPHVRADKKLSKIETLTLAKNYIKSLTATILTMSSSRLP GLEGPGPKLYQHYQQQQQVAGGALGATEAQPQGHLQRYSTQIHSFREGT myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_803238 |
RefSeq Size | 588 |
RefSeq ORF | 567 |
Synonyms | BHLHB8; MIST1 |
Locus ID | 168620 |
Cytogenetics | 7q21.3 |
Summary | Plays a role in controlling the transcriptional activity of MYOD1, ensuring that expanding myoblast populations remain undifferentiated. Repression may occur through muscle-specific E-box occupancy by homodimers. May also negatively regulate bHLH-mediated transcription through an N-terminal repressor domain. Serves as a key regulator of acinar cell function, stability, and identity. Also required for normal organelle localization in exocrine cells and for mitochondrial calcium ion transport. May function as a unique regulator of gene expression in several different embryonic and postnatal cell lineages. Binds to the E-box consensus sequence 5'-CANNTG-3' (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Pathways | Maturity onset diabetes of the young |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406171 | BHLHA15 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406171 | Transient overexpression lysate of basic helix-loop-helix family, member a15 (BHLHA15) |
CNY 3,080.00 |
|
TP315938 | Recombinant protein of human basic helix-loop-helix family, member a15 (BHLHA15), 20 µg |
CNY 2,900.00 |
其它BHLHA15产品