HIST1H2AH (NM_080596) Human Mass Spec Standard
CAT#: PH315831
HIST1H2AH MS Standard C13 and N15-labeled recombinant protein (NP_542163)
View other "HIST1H2AH" proteins (3)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | HIST1H2AH MS Standard C13 and N15-labeled recombinant protein (NP_542163) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215831 |
Predicted MW | 13.9 kDa |
Protein Sequence |
>RC215831 protein sequence
Red=Cloning site Green=Tags(s) MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNA ARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_542163 |
RefSeq Size | 481 |
RefSeq ORF | 384 |
Synonyms | dJ86C11.1; H2A/S; H2AFALii; H2AH; HIST1H2AH |
Locus ID | 85235 |
Cytogenetics | 6p22.1 |
Summary | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H2A family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the histone microcluster on chromosome 6p21.33. [provided by RefSeq, Aug 2015] |
Protein Pathways | Systemic lupus erythematosus |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409142 | HIST1H2AH HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY409142 | Transient overexpression lysate of histone cluster 1, H2ah (HIST1H2AH) |
CN¥ 3,080.00 |
|
TP315831 | Recombinant protein of human histone cluster 1, H2ah (HIST1H2AH), 20 µg |
CN¥ 2,900.00 |
其它HIST1H2AH产品