Septin 3 (SEPT3) (NM_145733) Human Mass Spec Standard
CAT#: PH315771
SEPT3 MS Standard C13 and N15-labeled recombinant protein (NP_663786)
View other "Septin 3" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | SEPT3 MS Standard C13 and N15-labeled recombinant protein (NP_663786) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215771 |
Predicted MW | 40.5 kDa |
Protein Sequence |
>RC215771 representing NM_145733
Red=Cloning site Green=Tags(s) MSKGLPETRTDAAMSELVPEPRPKPAVPMKPMSINSNLLGYIGIDTIIEQMRKKTMKTGFDFNIMVVGQS GLGKSTLVNTLFKSQVSRKASSWNREEKIPKTVEIKAIGHVIEEGGVKMKLTVIDTPGFGDQINNENCWE PIEKYINEQYEKFLKEEVNIARKKRIPDTRVHCCLYFISPTGHSLRPLDLEFMKHLSKVVNIIPVIAKAD TMTLEEKSEFKQRVRKELEVNGIEFYPQKEFDEDLEDKTENDKIRQESMPFAVVGSDKEYQVNGKRVLGR KTPWGIIEVENLNHCEFALLRDFVIRTHLQDLKEVTHNIHYETYRAKRLNDNGGLPPGEGLLGTVLPPVP ATPCPTAE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_663786 |
RefSeq Size | 2469 |
RefSeq ORF | 1074 |
Synonyms | bK250D10.3; SEP3; SEPT3 |
Locus ID | 55964 |
Cytogenetics | 22q13.2 |
Summary | This gene belongs to the septin family of GTPases. Members of this family are required for cytokinesis. Expression is upregulated by retinoic acid in a human teratocarcinoma cell line. The specific function of this gene has not been determined. Alternative splicing of this gene results in several transcript variants encoding different isoforms. [provided by RefSeq, May 2018] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403438 | 42250 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC412748 | 42250 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403438 | Transient overexpression lysate of septin 3 (SEPT3), transcript variant A |
CNY 3,080.00 |
|
LY412748 | Transient overexpression lysate of septin 3 (SEPT3), transcript variant B |
CNY 3,080.00 |
|
PH315714 | SEPT3 MS Standard C13 and N15-labeled recombinant protein (NP_061979) |
CNY 19,520.00 |
|
TP315714 | Recombinant protein of human septin 3 (SEPT3), transcript variant B, 20 µg |
CNY 2,900.00 |
|
TP315771 | Recombinant protein of human septin 3 (SEPT3), transcript variant A, 20 µg |
CNY 2,900.00 |
其它Septin 3产品