IFI27L1 (NM_145249) Human Mass Spec Standard
CAT#: PH315576
IFI27L1 MS Standard C13 and N15-labeled recombinant protein (NP_660292)
View other "IFI27L1" proteins (5)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
CN¥ 3,080.00
Specifications
Product Data | |
Description | IFI27L1 MS Standard C13 and N15-labeled recombinant protein (NP_660292) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215576 |
Predicted MW | 9.5 kDa |
Protein Sequence |
>RC215576 protein sequence
Red=Cloning site Green=Tags(s) MGKESGWDSGRAAVAAVVGGVVAVGTVLVALSAMGFTSVGIAASSIAAKMMSTAAIANGGGVAAGSLVAI LQSVGAAGLSVTSKVIGGFAGTALGAWLGSPPSS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_660292 |
RefSeq Size | 732 |
RefSeq ORF | 312 |
Synonyms | FAM14B; ISG12C |
Locus ID | 122509 |
Cytogenetics | 14q32.12 |
Summary | Plays a role in the apoptotic process and has a pro-apoptotic activity.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404190 | IFI27L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC407983 | IFI27L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY404190 | Transient overexpression lysate of interferon, alpha-inducible protein 27-like 1 (IFI27L1), transcript variant 2 |
CN¥ 3,080.00 |
|
LY407983 | Transient overexpression lysate of interferon, alpha-inducible protein 27-like 1 (IFI27L1), transcript variant 1 |
CN¥ 3,080.00 |
|
TP315576 | Recombinant protein of human interferon, alpha-inducible protein 27-like 1 (IFI27L1), transcript variant 1, 20 µg |
CN¥ 2,900.00 |
其它IFI27L1产品