H1oo (H1FOO) (NM_153833) Human Mass Spec Standard
CAT#: PH315554
H1FOO MS Standard C13 and N15-labeled recombinant protein (NP_722575)
View other "H1oo" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | H1FOO MS Standard C13 and N15-labeled recombinant protein (NP_722575) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215554 |
Predicted MW | 35.6 kDa |
Protein Sequence |
>RC215554 representing NM_153833
Red=Cloning site Green=Tags(s) MAPGSVTSDISPSSTSTAGSSRSPESEKPGPSHGGVPPGGPSHSSLPVGRRHPPVLRMVLEALQAGEQRR GTSVAAIKLYILHKYPTVDVLRFKYLLKQALATGMRRGLLARPLNSKARGATGSFKLVPKHKKKIQPRKM APATAPRRAGEAKGKGPKKPSEAKEDPPNVGKVKKAAKRPAKVQKPPPKPGAATEKARKQGGAAKDTRAQ SGEARKVPPKPDKAMRAPSSAGGLSRKAKAKGSRSSQGDAEAYRKTKAESKSSKPTASKVKNGAASPTKK KVVAKAKAPKAGQGPNTKAAAPAKGSGSKVVPAHLSRKTEAPKGPRKAGLPIKASSSKVSSQRAEA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_722575 |
RefSeq Size | 1067 |
RefSeq ORF | 1038 |
Synonyms | H1.8; H1FOO; H1oo; osH1 |
Locus ID | 132243 |
Cytogenetics | 3q22.1 |
Summary | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. The protein encoded is a replication-independent histone that is a member of the histone H1 family. This gene contains introns, unlike most histone genes. The related mouse gene is expressed only in oocytes. [provided by RefSeq, Oct 2015] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406918 | H1FOO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406918 | Transient overexpression lysate of H1 histone family, member O, oocyte-specific (H1FOO) |
CNY 3,080.00 |
|
TP315554 | Recombinant protein of human H1 histone family, member O, oocyte-specific (H1FOO), 20 µg |
CNY 2,900.00 |