B3GALT5 (NM_006057) Human Mass Spec Standard
CAT#: PH315430
B3GALT5 MS Standard C13 and N15-labeled recombinant protein (NP_006048)
View other "B3GALT5" proteins (19)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
Specifications
Product Data | |
Description | B3GALT5 MS Standard C13 and N15-labeled recombinant protein (NP_006048) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215430 |
Predicted MW | 36.2 kDa |
Protein Sequence |
>RC215430 protein sequence
Red=Cloning site Green=Tags(s) MAFPKMRLMYICLLVLGALCLYFSMYSLNPFKEQSFVYKKDGNFLKLPDTDCRQTPPFLVLLVTSSHKQL AERMAIRQTWGKERTVKGKQLKTFFLLGTTSSAAETKEVDQESQRHGDIIQKDFLDVYYNLTLKTMMGIE WVHRFCPQAAFVMKTDSDMFINVDYLTELLLKKNRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRY PPFCSGTGYVFSGDVASQVYNVSKSVPYIKLEDVFVGLCLERLNIRLEELHSQPTFFPGGLRFSVCLFRR IVACHFIKPRTLLDYWQALENSRGEDCPPV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006048 |
RefSeq Size | 2786 |
RefSeq ORF | 930 |
Synonyms | 3-GalTase 5; B3GalT-V; B3GalTx; B3T5; beta-1; beta-3-Gx-T5; beta3Gal-T5; GLCT5 |
Locus ID | 10317 |
Cytogenetics | 21q22.2 |
Summary | This gene encodes a member of a family of membrane-bound glycoproteins. The encoded protein may synthesize type 1 Lewis antigens, which are elevated in gastrointestinal and pancreatic cancers. Alternatively spliced transcript variants using multiple alternate promoters have been observed for this gene. [provided by RefSeq, Sep 2017] |
Protein Families | Transmembrane |
Protein Pathways | Glycosphingolipid biosynthesis - globo series, Glycosphingolipid biosynthesis - lacto and neolacto series, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409690 | B3GALT5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC409691 | B3GALT5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC409692 | B3GALT5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC409693 | B3GALT5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC416890 | B3GALT5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409690 | Transient overexpression lysate of UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 2 |
CNY 3,080.00 |
|
LY409691 | Transient overexpression lysate of UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 3 |
CNY 3,080.00 |
|
LY409692 | Transient overexpression lysate of UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 4 |
CNY 3,080.00 |
|
LY409693 | Transient overexpression lysate of UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 5 |
CNY 3,080.00 |
|
LY416890 | Transient overexpression lysate of UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 1 |
CNY 3,080.00 |
|
PH311183 | B3GALT5 MS Standard C13 and N15-labeled recombinant protein (NP_149363) |
CNY 14,250.00 |
|
PH313317 | B3GALT5 MS Standard C13 and N15-labeled recombinant protein (NP_149362) |
CNY 14,250.00 |
|
PH314669 | B3GALT5 MS Standard C13 and N15-labeled recombinant protein (NP_149360) |
CNY 14,250.00 |
|
PH314721 | B3GALT5 MS Standard C13 and N15-labeled recombinant protein (NP_149361) |
CNY 14,250.00 |
|
TP311183 | Purified recombinant protein of Homo sapiens UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 5, 20 µg |
CNY 2,900.00 |
|
TP313317 | Purified recombinant protein of Homo sapiens UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
TP314669 | Purified recombinant protein of Homo sapiens UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP314721 | Purified recombinant protein of Homo sapiens UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP315430 | Recombinant protein of human UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它B3GALT5产品