Protein cornichon homolog 2 (CNIH2) (NM_182553) Human Mass Spec Standard
CAT#: PH315357
CNIH2 MS Standard C13 and N15-labeled recombinant protein (NP_872359)
View other "Protein cornichon homolog 2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CNIH2 MS Standard C13 and N15-labeled recombinant protein (NP_872359) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215357 |
Predicted MW | 18.8 kDa |
Protein Sequence |
>RC215357 representing NM_182553
Red=Cloning site Green=Tags(s) MAFTFAAFCYMLTLVLCASLIFFVIWHIIAFDELRTDFKNPIDQGNPARARERLKNIERICCLLRKLVVP EYSIHGLFCLMFLCAAEWVTLGLNIPLLFYHLWRYFHRPADGSEVMYDAVSIMNADILNYCQKESWCKLA FYLLSFFYYLYSMVYTLVSF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_872359 |
RefSeq Size | 1399 |
RefSeq ORF | 480 |
Synonyms | CNIH-2; Cnil |
Locus ID | 254263 |
Cytogenetics | 11q13.2 |
Summary | The protein encoded by this gene is an auxiliary subunit of the ionotropic glutamate receptor of the AMPA subtype. AMPA receptors mediate fast synaptic neurotransmission in the central nervous system. This protein has been reported to interact with the Type I AMPA receptor regulatory protein isoform gamma-8 to control assembly of hippocampal AMPA receptor complexes, thereby modulating receptor gating and pharmacology. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405478 | CNIH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405478 | Transient overexpression lysate of cornichon homolog 2 (Drosophila) (CNIH2) |
CNY 3,080.00 |
|
TP315357 | Recombinant protein of human cornichon homolog 2 (Drosophila) (CNIH2), 20 µg |
CNY 2,900.00 |
其它Protein cornichon homolog 2产品