ARFGAP1 (NM_018209) Human Mass Spec Standard
CAT#: PH315268
ARFGAP1 MS Standard C13 and N15-labeled recombinant protein (NP_060679)
View other "ARFGAP1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
Product Data | |
Description | ARFGAP1 MS Standard C13 and N15-labeled recombinant protein (NP_060679) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215268 |
Predicted MW | 44.5 kDa |
Protein Sequence |
>RC215268 representing NM_018209
Red=Cloning site Green=Tags(s) MASPRTRKVLKEVRVQDENNVCFECGAFNPQWVSVTYGIWICLECSGRHRGLGVHLSFVRSVTMDKWKDI ELEKMKAGGNAKFREFLESQEDYDPCWSLQEKYNSRAAALFRDKVVALAEGREWSLESSPAQNWTPPQPR TLPSMVHRVSGQPQSVTASSDKAFEDWLNDDLGSYQGAQGNRYVGFGNTPPPQKKEDDFLNNAMSSLYSG WSSFTTGASRFASAAKEGATKFGSQASQKASELGHSLNENVLKPAQEKVKEGKIFDDVSSGVSQLASKVQ GVGSKGWRDVTTFFSGKAEGPLDSPSEGHSYQNSGLDHFQNSNIDQSFWETFGSAEPTKTRKSPSSDSWT CADTSTERRSSDSWEVWGSASTNRNSNSDGGEGGEGTKKAVPPAVPTDDGWDNQNW myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_060679 |
RefSeq Size | 3250 |
RefSeq ORF | 1218 |
Synonyms | ARF1GAP; HRIHFB2281 |
Locus ID | 55738 |
Cytogenetics | 20q13.33 |
Summary | The protein encoded by this gene is a GTPase-activating protein, which associates with the Golgi apparatus and which interacts with ADP-ribosylation factor 1. The encoded protein promotes hydrolysis of ADP-ribosylation factor 1-bound GTP and is required for the dissociation of coat proteins from Golgi-derived membranes and vesicles. Dissociation of the coat proteins is required for the fusion of these vesicles with target compartments. The activity of this protein is stimulated by phosphoinosides and inhibited by phosphatidylcholine. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
Protein Pathways | Endocytosis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406240 | ARFGAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC413218 | ARFGAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406240 | Transient overexpression lysate of ADP-ribosylation factor GTPase activating protein 1 (ARFGAP1), transcript variant 2 |
CNY 3,080.00 |
|
LY413218 | Transient overexpression lysate of ADP-ribosylation factor GTPase activating protein 1 (ARFGAP1), transcript variant 1 |
CNY 3,080.00 |
|
PH306987 | ARFGAP1 MS Standard C13 and N15-labeled recombinant protein (NP_783202) |
CNY 19,520.00 |
|
TP306987 | Recombinant protein of human ADP-ribosylation factor GTPase activating protein 1 (ARFGAP1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP315268 | Recombinant protein of human ADP-ribosylation factor GTPase activating protein 1 (ARFGAP1), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它ARFGAP1产品