IL21 (NM_021803) Human Mass Spec Standard
CAT#: PH315235
IL21 MS Standard C13 and N15-labeled recombinant protein (NP_068575)
View other "IL21" proteins (5)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | IL21 MS Standard C13 and N15-labeled recombinant protein (NP_068575) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215235 |
Predicted MW | 18.5 kDa |
Protein Sequence |
>RC215235 representing NM_021803
Red=Cloning site Green=Tags(s) MRSSPGNMERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETN CEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERF KSLLQKMIHQHLSSRTHGSEDS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_068575 |
RefSeq Size | 642 |
RefSeq ORF | 486 |
Synonyms | CVID11; IL-21; Za11 |
Locus ID | 59067 |
Cytogenetics | 4q27 |
Summary | This gene encodes a member of the common-gamma chain family of cytokines with immunoregulatory activity. The encoded protein plays a role in both the innate and adaptive immune responses by inducing the differentiation, proliferation and activity of multiple target cells including macrophages, natural killer cells, B cells and cytotoxic T cells. Dysregulation of this gene plays a role in multiple immune-mediated diseases including lupus, psoriasis and chronic inflammatory diseases. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411922 | IL21 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY411922 | Transient overexpression lysate of interleukin 21 (IL21) |
CN¥ 3,080.00 |
|
TP315235 | Recombinant protein of human interleukin 21 (IL21), 20 µg |
CN¥ 2,900.00 |
|
TP721084 | Purified recombinant protein of Human interleukin 21 (IL21), transcript variant 1 |
CN¥ 1,800.00 |
|
TP723716 | Purified recombinant protein of Human interleukin 21 (IL21), transcript variant 1 |
CN¥ 5,150.00 |