United States
Germany
Japan
United Kingdom
China
ARMC8 (NM_213654) Human Mass Spec Standard
CAT＃: PH315221
ARMC8 MS Standard C13 and N15-labeled recombinant protein (NP_998819)
View other "ARMC8" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | ARMC8 MS Standard C13 and N15-labeled recombinant protein (NP_998819) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC215221 |
| Predicted MW | 43 kDa |
| Protein Sequence |
>RC215221 protein sequence
Red=Cloning site Green=Tags(s) MEVTASSRHYVDRLFDPDPQKVLQGVIDMKNAVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECA VVLGSLAMGTENNVKSLLDCHIIPALLQGLLSPDLKFIEACLRCLRTIFTSPVTPEELLYTDATVIPHLM ALLSRSRYTQEYICQIFSHCCKGPDHQTILFNHGAVQNIAHLLTSLSYKVRMQALKCFSVLAFENPQVSM TLVNVLVDGELLPQIFVKMLQRDKPIEMQLTSAKCLTYMCRAGAIRTDDNCIVLKTLPCLVRMCSKERLL EERVEGAETLAYLIEPDVELQRIASITDHLIAMLADYFKYPSSVSAITDIKRLDHDLKHAHELRQAAFKL YASLGANDEDIRKKVSLGEGRPPVLTASRQGVTST myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_998819 |
| RefSeq Size | 3290 |
| RefSeq ORF | 1155 |
| Synonyms | GID5; HSPC056; S863-2; VID28 |
| Locus ID | 25852 |
| Cytogenetics | 3q22.3 |
| Summary | Component of the CTLH E3 ubiquitin-protein ligase complex that selectively accepts ubiquitin from UBE2H and mediates ubiquitination and subsequent proteasomal degradation of the transcription factor HBP1.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402281 | ARMC8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC403732 | ARMC8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC414566 | ARMC8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402281 | Transient overexpression lysate of armadillo repeat containing 8 (ARMC8), transcript variant 1 |
CNY 3,080.00 |
|
| LY403732 | Transient overexpression lysate of armadillo repeat containing 8 (ARMC8), transcript variant 3 |
CNY 3,080.00 |
|
| LY414566 | Transient overexpression lysate of armadillo repeat containing 8 (ARMC8), transcript variant 2 |
CNY 3,080.00 |
|
| PH302341 | ARMC8 MS Standard C13 and N15-labeled recombinant protein (NP_054873) |
CNY 19,520.00 |
|
| PH307532 | ARMC8 MS Standard C13 and N15-labeled recombinant protein (NP_056211) |
CNY 19,520.00 |
|
| TP302341 | Recombinant protein of human armadillo repeat containing 8 (ARMC8), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP307532 | Recombinant protein of human armadillo repeat containing 8 (ARMC8), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP315221 | Recombinant protein of human armadillo repeat containing 8 (ARMC8), transcript variant 3, 20 µg |
CNY 2,900.00 |
