RGS11 (NM_183337) Human Mass Spec Standard
CAT#: PH315185
RGS11 MS Standard C13 and N15-labeled recombinant protein (NP_899180)
View other "RGS11" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | RGS11 MS Standard C13 and N15-labeled recombinant protein (NP_899180) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215185 |
Predicted MW | 52.8 kDa |
Protein Sequence |
>RC215185 representing NM_183337
Red=Cloning site Green=Tags(s) MAAGPAPPPGRPRAQMPHLRKMERVVVSMQDPDQGVKMRSQRLLVTVIPHAVTGSDVVQWLAQKFCVSEE EALHLGAVLVQHGYIYPLRDPRSLMLRPDETPYRFQTPYFWTSTLRPAAELDYAIYLAKKNIRKRGTLVD YEKDCYDRLHKKINHAWDLVLMQAREQLRAAKQRSKGDRLVIACQEQTYWLVNRPPPGAPDVLEQGPGRG SCAASRVLMTKSADFHKREIEYFRKALGRTRVKSSVCLEAYLSFCGQRGPHDPLVSGCLPSNPWISDNDA YWVMNAPTVAAPTKLRVERWGFSFRELLEDPVGRAHFMDFLGKEFSGENLSFWEACEELRYGAQAQVPTL VDAVYEQFLAPGAAHWVNIDSRTMEQTLEGLRQPHRYVLDDAQLHIYMLMKKDSYPRFLKSDMYKALLAE AGIPLEMKRRVFPFTWRPRHSSPSPALLPTPVEPTAACGPGGGDGVA SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_899180 |
RefSeq Size | 2373 |
RefSeq ORF | 1401 |
Synonyms | RS11 |
Locus ID | 8786 |
Cytogenetics | 16p13.3 |
Summary | The protein encoded by this gene belongs to the RGS (regulator of G protein signaling) family. Members of the RGS family act as GTPase-activating proteins on the alpha subunits of heterotrimeric, signal-transducing G proteins. This protein inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form. Alternative splicing occurs at this locus and four transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Nov 2013] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405244 | RGS11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC418405 | RGS11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY405244 | Transient overexpression lysate of regulator of G-protein signaling 11 (RGS11), transcript variant 1 |
CNY 4,840.00 |
|
LY418405 | Transient overexpression lysate of regulator of G-protein signaling 11 (RGS11), transcript variant 2 |
CNY 4,840.00 |
|
PH314542 | RGS11 MS Standard C13 and N15-labeled recombinant protein (NP_003825) |
CNY 14,250.00 |
|
TP314542 | Recombinant protein of human regulator of G-protein signaling 11 (RGS11), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP315185 | Recombinant protein of human regulator of G-protein signaling 11 (RGS11), transcript variant 1, 20 µg |
CNY 2,900.00 |