Adiponectin (ADIPOQ) (NM_004797) Human Mass Spec Standard
CAT#: PH315161
ADIPOQ MS Standard C13 and N15-labeled recombinant protein (NP_004788)
View other "Adiponectin" proteins (10)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ADIPOQ MS Standard C13 and N15-labeled recombinant protein (NP_004788) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215161 |
Predicted MW | 26.41 kDa |
Protein Sequence |
>RC215161 representing NM_004797
Red=Cloning site Green=Tags(s) MLLLGAVLLLLALPGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGD PGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQ NHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQ VWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004788 |
RefSeq Size | 4592 |
RefSeq ORF | 732 |
Synonyms | ACDC; ACRP30; ADIPQTL1; ADPN; APM-1; APM1; GBP28 |
Locus ID | 9370 |
Cytogenetics | 3q27.3 |
Summary | This gene is expressed in adipose tissue exclusively. It encodes a protein with similarity to collagens X and VIII and complement factor C1q. The encoded protein circulates in the plasma and is involved with metabolic and hormonal processes. Mutations in this gene are associated with adiponectin deficiency. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Apr 2010] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Adipocytokine signaling pathway, PPAR signaling pathway, Type II diabetes mellitus |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401510 | ADIPOQ HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432756 | ADIPOQ HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401510 | Transient overexpression lysate of adiponectin, C1Q and collagen domain containing (ADIPOQ) |
CNY 3,080.00 |
|
LY432756 | Transient overexpression lysate of adiponectin, C1Q and collagen domain containing (ADIPOQ), transcript variant 1 |
CNY 3,080.00 |
|
TP315161 | Recombinant protein of human adiponectin, C1Q and collagen domain containing (ADIPOQ), 20 µg |
CNY 2,900.00 |
|
TP700247 | Purified secreted form of human adiponectin, C1Q and collagen domain containing (ADIPOQ), with N-terminal His tag, expressed in human cells, 20ug |
CNY 6,650.00 |
|
TP710245 | Purified recombinant protein of Human adiponectin, C1Q and collagen domain containing (ADIPOQ), transcript variant 2, full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |
|
TP710246 | Purified recombinant protein of Human adiponectin, C1Q and collagen domain containing (ADIPOQ), transcript variant 2, residues 18-244aa, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |
|
TP720685 | Purified recombinant protein of Human adiponectin, C1Q and collagen domain containing (ADIPOQ), transcript variant 2 |
CNY 1,800.00 |
|
TP790074 | Purified recombinant protein of Human adiponectin, C1Q and collagen domain containing (ADIPOQ), transcript variant 2, esidues 19-244aa, with C-terminal DDK tag, secretory expressed in CHO cells, 50ug |
CNY 3,900.00 |
其它Adiponectin产品