FOXP2 (NM_014491) Human Mass Spec Standard
CAT#: PH315021
FOXP2 MS Standard C13 and N15-labeled recombinant protein (NP_055306)
View other "FOXP2" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | FOXP2 MS Standard C13 and N15-labeled recombinant protein (NP_055306) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215021 |
Predicted MW | 79.9 kDa |
Protein Sequence |
>RC215021 representing NM_014491
Red=Cloning site Green=Tags(s) MMQESATETISNSSMNQNGMSTLSSQLDAGSRDGRSSGDTSSEVSTVELLHLQQQQALQAARQLLLQQQT SGLKSPKSSDKQRPLQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQALLQQQQAVMLQQQQLQEFYK KQQEQLHLQLLQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQHPGKQAKEQQQQQQQQQQL AAQQLVFQQQLLQMQQLQQQQHLLSLQRQGLISIPPGQAALPVQSLPQAGLSPAEIQQLWKEVTGVHSME DNGIKHGGLDLTTNNSSSTTSSNTSKASPPITHHSIVNGQSSVLSARRDSSSHEETGASHTLYGHGVCKW PGCESICEDFGQFLKHLNNEHALDDRSTAQCRVQMQVVQQLEIQLSKERERLQAMMTHLHMRPSEPKPSP KPLNLVSSVTMSKNMLETSPQSLPQTPTTPTAPVTPITQGPSVITPASVPNVGAIRRRHSDKYNIPMSSE IAPNYEFYKNADVRPPFTYATLIRQAIMESSDRQLTLNEIYSWFTRTFAYFRRNAATWKNAVRHNLSLHK CFVRVENVKGAVWTVDEVEYQKRRSQKITGSPTLVKNIPTSLGYGAALNASLQAALAESSLPLLSNPGLI NNASSGLLQAVHEDLNGSLDHIDSNGNSSPGCSPQPHIHSIHVKEEPVIAEDEDCPMSLVTTANHSPELE DDREIEEEPLSEDLE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_055306 |
RefSeq Size | 6373 |
RefSeq ORF | 2145 |
Synonyms | CAGH44; SPCH1; TNRC10 |
Locus ID | 93986 |
Cytogenetics | 7q31.1 |
Summary | This gene encodes a member of the forkhead/winged-helix (FOX) family of transcription factors. It is expressed in fetal and adult brain as well as in several other organs such as the lung and gut. The protein product contains a FOX DNA-binding domain and a large polyglutamine tract and is an evolutionarily conserved transcription factor, which may bind directly to approximately 300 to 400 gene promoters in the human genome to regulate the expression of a variety of genes. This gene is required for proper development of speech and language regions of the brain during embryogenesis, and may be involved in a variety of biological pathways and cascades that may ultimately influence language development. Mutations in this gene cause speech-language disorder 1 (SPCH1), also known as autosomal dominant speech and language disorder with orofacial dyspraxia. Multiple alternative transcripts encoding different isoforms have been identified in this gene.[provided by RefSeq, Feb 2010] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407756 | FOXP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC415248 | FOXP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC429426 | FOXP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY407756 | Transient overexpression lysate of forkhead box P2 (FOXP2), transcript variant 3 |
CNY 4,840.00 |
|
LY415248 | Transient overexpression lysate of forkhead box P2 (FOXP2), transcript variant 1 |
CNY 4,840.00 |
|
TP315021 | Recombinant protein of human forkhead box P2 (FOXP2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP761959 | Purified recombinant protein of Human forkhead box P2 (FOXP2), transcript variant 3,full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2,050.00 |