United States
Germany
Japan
United Kingdom
China
EGFR (NM_201283) Human Mass Spec Standard
CAT＃: PH314877
EGFR MS Standard C13 and N15-labeled recombinant protein (NP_958440)
View other "EGFR" proteins (15)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 4,840.00
Specifications
| Product Data | |
| Description | EGFR MS Standard C13 and N15-labeled recombinant protein (NP_958440) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC214877 |
| Predicted MW | 42.4 kDa |
| Protein Sequence |
>RC214877 representing NM_201283
Red=Cloning site Green=Tags(s) MRPSGTAGAALLALLAALCPASRALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEVVLGNLEITYV QRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALAVLSNYDANKTGLKELPMRNL QEILHGAVRFSNNPALCNVESIQWRDIVSSDFLSNMSMDFQNHLGSCQKCDPSCPNGSCWGAGEENCQKL TKIICAQQCSGRCRGKSPSDCCHNQCAAGCTGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVN PEGKYSFGATCVKKCPRNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLS INATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGLS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_958440 |
| RefSeq Size | 1595 |
| RefSeq ORF | 1215 |
| Synonyms | ERBB; ERBB1; ERRP; HER1; mENA; NISBD2; PIG61 |
| Locus ID | 1956 |
| Cytogenetics | 7p11.2 |
| Summary | The protein encoded by this gene is a transmembrane glycoprotein that is a member of the protein kinase superfamily. This protein is a receptor for members of the epidermal growth factor family. EGFR is a cell surface protein that binds to epidermal growth factor, thus inducing receptor dimerization and tyrosine autophosphorylation leading to cell proliferation. Mutations in this gene are associated with lung cancer. EGFR is a component of the cytokine storm which contributes to a severe form of Coronavirus Disease 2019 (COVID-19) resulting from infection with severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2). [provided by RefSeq, Jul 2020] |
| Protein Families | Adult stem cells, Cancer stem cells, Druggable Genome, ES Cell Differentiation/IPS, Protein Kinase, Secreted Protein, Stem cell relevant signaling - JAK/STAT signaling pathway, Transmembrane |
| Protein Pathways | Adherens junction, Bladder cancer, Calcium signaling pathway, Colorectal cancer, Cytokine-cytokine receptor interaction, Dorso-ventral axis formation, Endocytosis, Endometrial cancer, Epithelial cell signaling in Helicobacter pylori infection, ErbB signaling pathway, Focal adhesion, Gap junction, Glioma, GnRH signaling pathway, MAPK signaling pathway, Melanoma, Non-small cell lung cancer, Pancreatic cancer, Pathways in cancer, Prostate cancer, Regulation of actin cytoskeleton |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404514 | EGFR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC404515 | EGFR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417434 | EGFR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LY404514 | Transient overexpression lysate of epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian) (EGFR), transcript variant 2 |
CNY 4,840.00 |
|
| LY404515 | Transient overexpression lysate of epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian) (EGFR), transcript variant 3 |
CNY 3,080.00 |
|
| LY417434 | Transient overexpression lysate of epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian) (EGFR), transcript variant 1 |
CNY 4,840.00 |
|
| TP314877 | Recombinant protein of human epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian) (EGFR), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP700043 | Recombinant protein of human epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian) (EGFR),residues 25-645 aa, expressed in human cells |
CNY 6,650.00 |
|
| TP700065 | Purified protein of Homo sapiens epidermal growth factor receptor (EGFR), transcript variant 1, mutant L858R, with C-terminal MYC/DDK tag, expressed in human cells, 20ug |
CNY 6,650.00 |
|
| TP700080 | Purified protein of Homo sapiens epidermal growth factor receptor (EGFR), transcript variant 1, mutant K745_K750del, with C-terminal MYC/DDK tag, expressed in human cells, 20ug |
CNY 6,650.00 |
|
| TP700103 | Purified recombinant protein of Human epidermal growth factor receptor (EGFR), transcript variant 3, with C-terminal DDK/His tag, expressed in human cells |
CNY 6,650.00 |
|
| TP700204 | Purified recombinant protein of Human epidermal growth factor receptor (EGFR) extracellular domain, residues Leu25-Gly378, transcript variant 3 |
CNY 2,900.00 |
|
| TP710003 | Recombinant protein of human epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian) (EGFR),residues 1-645aa,expressed in sf9 cells |
CNY 4,020.00 |
|
| TP710011 | Recombinant protein of human epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian) (EGFR), full length, with C-terminal DDK tag, expressed in sf9 cells |
CNY 4,020.00 |
|
| TP710358 | Purified recombinant protein of Human epidermal growth factor receptor (EGFR), transcript variant 1, esidues 669-1210aa, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |
