MOCS2 (NM_176806) Human Mass Spec Standard
CAT#: PH314804
MOCS2 MS Standard C13 and N15-labeled recombinant protein (NP_789776)
View other "MOCS2" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
Specifications
Product Data | |
Description | MOCS2 MS Standard C13 and N15-labeled recombinant protein (NP_789776) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214804 |
Predicted MW | 9.6 kDa |
Protein Sequence |
>RC214804 representing NM_176806
Red=Cloning site Green=Tags(s) MVPLCQVEVLYFAKSAEITGVRSETISVPQEIKALQLWKEIETRHPGLADVRNQIIFAVRQEYVELGDQL LVLQPGDEIAVIPPISGG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_789776 |
RefSeq Size | 1347 |
RefSeq ORF | 264 |
Synonyms | MCBPE; MOCO1; MOCODB; MPTS |
Locus ID | 4338 |
Cytogenetics | 5q11.2 |
Summary | Eukaryotic molybdoenzymes use a unique molybdenum cofactor (MoCo) consisting of a pterin, termed molybdopterin, and the catalytically active metal molybdenum. MoCo is synthesized from precursor Z by the heterodimeric enzyme molybdopterin synthase. The large and small subunits of molybdopterin synthase are both encoded from this gene by overlapping open reading frames. The proteins were initially thought to be encoded from a bicistronic transcript. They are now thought to be encoded from monocistronic transcripts. Alternatively spliced transcripts have been found for this locus that encode the large and small subunits. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406129 | MOCS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC417924 | MOCS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406129 | Transient overexpression lysate of molybdenum cofactor synthesis 2 (MOCS2), transcript variant 1 |
CNY 3,080.00 |
|
LY417924 | Transient overexpression lysate of molybdenum cofactor synthesis 2 (MOCS2), transcript variant 3 |
CNY 3,080.00 |
|
PH308485 | MOCS2 MS Standard C13 and N15-labeled recombinant protein (NP_004522) |
CNY 19,520.00 |
|
TP308485 | Recombinant protein of human molybdenum cofactor synthesis 2 (MOCS2), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP314804 | Recombinant protein of human molybdenum cofactor synthesis 2 (MOCS2), transcript variant 1, 20 µg |
CNY 2,900.00 |