OTC (Ornithine Carbamoyltransferase (OTC)) (NM_000531) Mass Spec Standard
CAT#: PH314662
OTC MS Standard C13 and N15-labeled recombinant protein (NP_000522)
View other "Ornithine Carbamoyltransferase" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 18,953.00
Product images

Specifications
Product Data | |
Description | OTC MS Standard C13 and N15-labeled recombinant protein (NP_000522) |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214662 |
Predicted MW | 39.94 kDa |
Protein Sequence |
>RC214662 representing NM_000531
Red=Cloning site Green=Tags(s) MLFNLRILLNNAAFRNGHNFMVRNFRCGQPLQNKVQLKGRDLLTLKNFTGEEIKYMLWLSADLKFRIKQK GEYLPLLQGKSLGMIFEKRSTRTRLSTETGFALLGGHPCFLTTQDIHLGVNESLTDTARVLSSMADAVLA RVYKQSDLDTLAKEASIPIINGLSDLYHPIQILADYLTLQEHYSSLKGLTLSWIGDGNNILHSIMMSAAK FGMHLQAATPKGYEPDASVTKLAEQYAKENGTKLLLTNDPLEAAHGGNVLITDTWISMGQEEEKKKRLQA FQGYQVTMKTAKVAASDWTFLHCLPRKPEEVDDEVFYSPRSLVFPEAENRKWTIMAVMVSLLTDYSPQLQ KPKF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000522 |
RefSeq Size | 1927 |
RefSeq ORF | 1062 |
Synonyms | OCTD; OTCD |
Locus ID | 5009 |
Cytogenetics | Xp11.4 |
Summary | This nuclear gene encodes a mitochondrial matrix enzyme. Missense, nonsense, and frameshift mutations in this enzyme lead to ornithine transcarbamylase deficiency, which causes hyperammonemia. Since the gene for this enzyme maps close to that for Duchenne muscular dystrophy, it may play a role in that disease also. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Arginine and proline metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LY400179 | Transient overexpression lysate of ornithine carbamoyltransferase (OTC), nuclear gene encoding mitochondrial protein |
CNY 2,990.00 |
|
TP314662 | Purified recombinant protein of Homo sapiens ornithine carbamoyltransferase (OTC), nuclear gene encoding mitochondrial protein, 20 µg |
CNY 2,900.00 |
|
TP710189 | Purified recombinant protein of Human ornithine carbamoyltransferase (OTC / OCTD), nuclear gene encoding mitochondrial protein, residues 33-354 aa, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |
|
TP760822 | Purified recombinant protein of Human ornithine carbamoyltransferase (OTC), nuclear gene encoding mitochondrial protein, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
其它Ornithine Carbamoyltransferase产品