United States
Germany
Japan
United Kingdom
China
Calcitonin (CALCA) (NM_001741) Human Mass Spec Standard
CAT＃: PH314594
CALCA MS Standard C13 and N15-labeled recombinant protein (NP_001732)
View other "Calcitonin" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | CALCA MS Standard C13 and N15-labeled recombinant protein (NP_001732) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC214594 |
| Predicted MW | 15.5 kDa |
| Protein Sequence |
>RC214594 protein sequence
Red=Cloning site Green=Tags(s) MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSEDEARLLLAALVQDYVQMKASELEQEQ EREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNA N myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001732 |
| RefSeq Size | 792 |
| RefSeq ORF | 423 |
| Synonyms | CALC1; CGRP; CGRP-alpha; CGRP-I; CGRP1; CT; KC; PCT |
| Locus ID | 796 |
| Cytogenetics | 11p15.2 |
| Summary | This gene encodes the peptide hormones calcitonin, calcitonin gene-related peptide and katacalcin by tissue-specific alternative RNA splicing of the gene transcripts and cleavage of inactive precursor proteins. Calcitonin is involved in calcium regulation and acts to regulate phosphorus metabolism. Calcitonin gene-related peptide functions as a vasodilator and as an antimicrobial peptide while katacalcin is a calcium-lowering peptide. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Aug 2014] |
| Protein Families | Druggable Genome, Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419771 | CALCA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422430 | CALCA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419771 | Transient overexpression lysate of calcitonin-related polypeptide alpha (CALCA), transcript variant 1 |
CNY 3,080.00 |
|
| LY422430 | Transient overexpression lysate of calcitonin-related polypeptide alpha (CALCA), transcript variant 2 |
CNY 3,080.00 |
|
| TP314594 | Recombinant protein of human calcitonin-related polypeptide alpha (CALCA), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP720503 | Recombinant protein of human calcitonin-related polypeptide alpha (CALCA) |
CNY 3,140.00 |
|
| TP720989 | Purified recombinant protein of Human calcitonin-related polypeptide alpha (CALCA), transcript variant 2 |
CNY 3,140.00 |
|
| TP750123 | Purified recombinant protein of Human calcitonin-related polypeptide alpha (PCT), transcript variant 1, N-terminal His tag, expressed in E. coli, 50ug |
CNY 2,000.00 |
其它Calcitonin产品
