United States
Germany
Japan
United Kingdom
China
FGR (NM_005248) Human Mass Spec Standard
CAT＃: PH314458
FGR MS Standard C13 and N15-labeled recombinant protein (NP_005239)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | FGR MS Standard C13 and N15-labeled recombinant protein (NP_005239) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC214458 |
| Predicted MW | 59.3 kDa |
| Protein Sequence |
>RC214458 representing NM_005248
Red=Cloning site Green=Tags(s) MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQAINPGFLDSGT IRGVSGIGVTLFIALYDYEARTEDDLTFTKGEKFHILNNTEGDWWEARSLSSGKTGCIPSNYVAPVDSIQ AEEWYFGKIGRKDAERQLLSPGNPQGAFLIRESETTKGAYSLSIRDWDQTRGDHVKHYKIRKLDMGGYYI TTRVQFNSVQELVQHYMEVNDGLCNLLIAPCTIMKPQTLGLAKDAWEISRSSITLERRLGTGCFGDVWLG TWNGSTKVAVKTLKPGTMSPKAFLEEAQVMKLLRHDKLVQLYAVVSEEPIYIVTEFMCHGSLLDFLKNPE GQDLRLPQLVDMAAQVAEGMAYMERMNYIHRDLRAANILVGERLACKIADFGLARLIKDDEYNPCQGSKF PIKWTAPEAALFGRFTIKSDVWSFGILLTELITKGRIPYPGMNKREVLEQVEQGYHMPCPPGCPASLYEA MEQTWRLDPEERPTFEYLQSFLEDYFTSAEPQYQPGDQT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005239 |
| RefSeq Size | 2354 |
| RefSeq ORF | 1587 |
| Synonyms | c-fgr; c-src2; p55-Fgr; p55c-fgr; p58-Fgr; p58c-fgr; SRC2 |
| Locus ID | 2268 |
| Cytogenetics | 1p35.3 |
| Summary | This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. The protein localizes to plasma membrane ruffles, and functions as a negative regulator of cell migration and adhesion triggered by the beta-2 integrin signal transduction pathway. Infection with Epstein-Barr virus results in the overexpression of this gene. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Protein Kinase |
| Protein Pathways | Chemokine signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401612 | FGR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420800 | FGR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420802 | FGR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LY401612 | Transient overexpression lysate of Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog (FGR), transcript variant 1 |
CNY 3,080.00 |
|
| LY420800 | Transient overexpression lysate of Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog (FGR), transcript variant 3 |
CNY 3,080.00 |
|
| LY420802 | Transient overexpression lysate of Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog (FGR), transcript variant 2 |
CNY 4,840.00 |
|
| TP314458 | Recombinant protein of human Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog (FGR), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP761663 | Purified recombinant protein of uman Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog (FGR), transcript variant 3, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
