United States
Germany
Japan
United Kingdom
China
SCML1 (NM_001037535) Human Mass Spec Standard
CAT＃: PH314112
SCML1 MS Standard C13 and N15-labeled recombinant protein (NP_001032624)
View other "SCML1" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Product images
Specifications
| Product Data | |
| Description | SCML1 MS Standard C13 and N15-labeled recombinant protein (NP_001032624) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC214112 |
| Predicted MW | 34.22 kDa |
| Protein Sequence |
>RC214112 representing NM_001037535
Red=Cloning site Green=Tags(s) MMSNSSSEIDVQEPNIVSDASCNTEEQLKTVDDVLIHCQVIYDALQNLDKKIDVIRRKVSKIQRFHARSL WTNHKRYGYKKHSYRLVKKLKLQKMKKNEVYETFSYPESYSPTLPVSRRENNSPSNLPRPSFCMEEYQRA ELEEDPILSRTPSPVHPSDFSEHNCQPYYASDGATYGSSSGLCLGNPRADSIHNTYSTDHASAAPPSVTR SPVENDGYIEEGSITKHPSTWSVEAVVLFLKQTDPLALCPLVDLFRSHEIDGKALLLLTSDVLLKHLGVK LGTAVKLCYYIDRLKQGKCFEN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001032624 |
| RefSeq Size | 2693 |
| RefSeq ORF | 906 |
| Locus ID | 6322 |
| Cytogenetics | Xp22.13 |
| Summary | Putative Polycomb group (PcG) protein. PcG proteins act by forming multiprotein complexes, which are required to maintain the transcriptionally repressive state of homeotic genes throughout development. May be involved in spermatogenesis during sexual maturation (By similarity).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416443 | SCML1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421919 | SCML1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421922 | SCML1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416443 | Transient overexpression lysate of sex comb on midleg-like 1 (Drosophila) (SCML1), transcript variant 2 |
CNY 3,080.00 |
|
| LY421919 | Transient overexpression lysate of sex comb on midleg-like 1 (Drosophila) (SCML1), transcript variant 3 |
CNY 3,080.00 |
|
| LY421922 | Transient overexpression lysate of sex comb on midleg-like 1 (Drosophila) (SCML1), transcript variant 1 |
CNY 3,080.00 |
|
| PH312954 | SCML1 MS Standard C13 and N15-labeled recombinant protein (NP_001032629) |
CNY 14,250.00 |
|
| TP312954 | Purified recombinant protein of Homo sapiens sex comb on midleg-like 1 (Drosophila) (SCML1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP314112 | Recombinant protein of human sex comb on midleg-like 1 (Drosophila) (SCML1), transcript variant 3, 20 µg |
CNY 2,900.00 |
