Interferon alpha10 (IFNA10) (NM_002171) Human Mass Spec Standard
CAT#: PH314055
IFNA10 MS Standard C13 and N15-labeled recombinant protein (NP_002162)
View other "Interferon alpha10" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | IFNA10 MS Standard C13 and N15-labeled recombinant protein (NP_002162) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214055 |
Predicted MW | 21.7 kDa |
Protein Sequence |
>RC214055 representing NM_002171
Red=Cloning site Green=Tags(s) MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLGQMGRISPFSCLKDRHDFRIPQEEFDGNQ FQKAQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLEACVIQEVGVEETPLMNEDSI LAVRKYFQRITLYLIERKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002162 |
RefSeq Size | 963 |
RefSeq ORF | 567 |
Synonyms | IFN-alphaC |
Locus ID | 3446 |
Cytogenetics | 9p21.3 |
Summary | This gene encodes a protein that belongs to the type I interferon family of proteins, and is located in a cluster of alpha interferon genes on chromosome 9. Interferons are small regulatory molecules that function in cell signaling in response to viruses and other pathogens or tumor cells. This gene is intronless and the encoded protein is secreted. [provided by RefSeq, Aug 2013] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Antigen processing and presentation, Autoimmune thyroid disease, Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, Jak-STAT signaling pathway, Natural killer cell mediated cytotoxicity, Regulation of autophagy, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419488 | IFNA10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419488 | Transient overexpression lysate of interferon, alpha 10 (IFNA10) |
CNY 3,080.00 |
|
TP314055 | Recombinant protein of human interferon, alpha 10 (IFNA10), 20 µg |
CNY 2,900.00 |
其它Interferon alpha10产品