SKP2 (NM_005983) Human Mass Spec Standard
CAT#: PH314001
SKP2 MS Standard C13 and N15-labeled recombinant protein (NP_005974)
View other "SKP2" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SKP2 MS Standard C13 and N15-labeled recombinant protein (NP_005974) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214001 |
Predicted MW | 47.6 kDa |
Protein Sequence |
>RC214001 representing NM_005983
Red=Cloning site Green=Tags(s) MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLGHPESPPRKRL KSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTL DLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQN LSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAH VSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIP ETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQK PSCL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005974 |
RefSeq Size | 1600 |
RefSeq ORF | 1272 |
Synonyms | FBL1; FBXL1; FLB1; p45 |
Locus ID | 6502 |
Cytogenetics | 5p13.2 |
Summary | This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class; in addition to an F-box, this protein contains 10 tandem leucine-rich repeats. This protein is an essential element of the cyclin A-CDK2 S-phase kinase. It specifically recognizes phosphorylated cyclin-dependent kinase inhibitor 1B (CDKN1B, also referred to as p27 or KIP1) predominantly in S phase and interacts with S-phase kinase-associated protein 1 (SKP1 or p19). In addition, this gene is established as a protooncogene causally involved in the pathogenesis of lymphomas. Alternative splicing of this gene generates three transcript variants encoding different isoforms. [provided by RefSeq, Jul 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Acute myeloid leukemia, Apoptosis, Cell cycle, Oocyte meiosis, p53 signaling pathway, Pathways in cancer, Progesterone-mediated oocyte maturation, Small cell lung cancer, Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401815 | SKP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY401815 | Transient overexpression lysate of S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 1 |
CNY 4,840.00 |
|
TP314001 | Recombinant protein of human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP760651 | Purified recombinant protein of Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 1, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |