United States
Germany
Japan
United Kingdom
China
PPP2R5C (NM_002719) Human Mass Spec Standard
CAT＃: PH314000
PPP2R5C MS Standard C13 and N15-labeled recombinant protein (NP_002710)
View other "PPP2R5C" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Product images
Specifications
| Product Data | |
| Description | PPP2R5C MS Standard C13 and N15-labeled recombinant protein (NP_002710) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC214000 |
| Predicted MW | 60.9 kDa |
| Protein Sequence |
>RC214000 representing NM_002719
Red=Cloning site Green=Tags(s) MLTCNKAGSRMVVDAANSNGPFQPVVLLHIRDVPPADQEKLFIQKLRQCCVLFDFVSDPLSDLKWKEVKR AALSEMVEYITHNRNVITEPIYPEVVHMFAVNMFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEF FLRFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGKFLGLRAYIRKQINNIFYR FIYETEHHNGIAELLEILGSIINGFALPLKEEHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDST LTEPVVMALLKYWPKTHSPKEVMFLNELEEILDVIEPSEFVKIMEPLFRQLAKCVSSPHFQVAERALYYW NNEYIMSLISDNAAKILPIMFPSLYRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEK LKMKEREEAWVKIENLAKANPQYTVYSQASTMSIPVAMETDGPLFEDVQMLRKTVKDEAHQAQKDPKKDR PLARRKSELPQDPHTKKALEAHCRADELASQDGR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002710 |
| RefSeq Size | 4167 |
| RefSeq ORF | 1572 |
| Synonyms | B56G; B56gamma; PR61G |
| Locus ID | 5527 |
| Cytogenetics | 14q32.31 |
| Summary | The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a gamma isoform of the regulatory subunit B56 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Phosphatase |
| Protein Pathways | Oocyte meiosis, Wnt signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405869 | PPP2R5C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC419145 | PPP2R5C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC431464 | PPP2R5C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431474 | PPP2R5C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405869 | Transient overexpression lysate of protein phosphatase 2, regulatory subunit B', gamma isoform (PPP2R5C), transcript variant 4 |
CNY 3,080.00 |
|
| LY419145 | Transient overexpression lysate of protein phosphatase 2, regulatory subunit B', gamma isoform (PPP2R5C), transcript variant 1 |
CNY 4,840.00 |
|
| LY431464 | Transient overexpression lysate of protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 6 |
CNY 3,080.00 |
|
| LY431474 | Transient overexpression lysate of protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 5 |
CNY 3,080.00 |
|
| TP314000 | Purified recombinant protein of Homo sapiens protein phosphatase 2, regulatory subunit B', gamma isoform (PPP2R5C), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它PPP2R5C产品
