Stathmin 1 (STMN1) (NM_005563) Human Mass Spec Standard
CAT#: PH313958
STMN1 MS Standard C13 and N15-labeled recombinant protein (NP_005554)
View other "Stathmin 1" proteins (13)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | STMN1 MS Standard C13 and N15-labeled recombinant protein (NP_005554) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC213958 |
Predicted MW | 17.1 kDa |
Protein Sequence |
>RC213958 representing NM_005563
Red=Cloning site Green=Tags(s) MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLK QLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESK DPADETEAD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005554 |
RefSeq Size | 1542 |
RefSeq ORF | 447 |
Synonyms | C1orf215; Lag; LAP18; OP18; PP17; PP19; PR22; SMN |
Locus ID | 3925 |
Cytogenetics | 1p36.11 |
Summary | This gene belongs to the stathmin family of genes. It encodes a ubiquitous cytosolic phosphoprotein proposed to function as an intracellular relay integrating regulatory signals of the cellular environment. The encoded protein is involved in the regulation of the microtubule filament system by destabilizing microtubules. It prevents assembly and promotes disassembly of microtubules. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2009] |
Protein Pathways | MAPK signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404338 | STMN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC404340 | STMN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC417225 | STMN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC429256 | STMN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY404338 | Transient overexpression lysate of stathmin 1 (STMN1), transcript variant 2 |
CN¥ 3,080.00 |
|
LY404340 | Transient overexpression lysate of stathmin 1 (STMN1), transcript variant 1 |
CN¥ 3,080.00 |
|
LY417225 | Transient overexpression lysate of stathmin 1 (STMN1), transcript variant 3 |
CN¥ 3,080.00 |
|
PH305073 | STMN1 MS Standard C13 and N15-labeled recombinant protein (NP_981946) |
CN¥ 19,520.00 |
|
PH320276 | STMN1 MS Standard C13 and N15-labeled recombinant protein (NP_981944) |
CN¥ 19,520.00 |
|
TP305073 | Recombinant protein of human stathmin 1/oncoprotein 18 (STMN1), transcript variant 1, 20 µg |
CN¥ 2,900.00 |
|
TP313958 | Recombinant protein of human stathmin 1/oncoprotein 18 (STMN1), transcript variant 3, 20 µg |
CN¥ 2,900.00 |
|
TP320276 | Recombinant protein of human stathmin 1/oncoprotein 18 (STMN1), transcript variant 2, 20 µg |
CN¥ 2,900.00 |
|
TP720152 | Recombinant protein of human stathmin 1/oncoprotein 18 (STMN1), transcript variant 4 |
CN¥ 1,800.00 |
其它Stathmin 1产品