HOXC6 (NM_004503) Human Mass Spec Standard
CAT#: PH313768
HOXC6 MS Standard C13 and N15-labeled recombinant protein (NP_004494)
View other "HOXC6" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | HOXC6 MS Standard C13 and N15-labeled recombinant protein (NP_004494) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC213768 |
Predicted MW | 26.7 kDa |
Protein Sequence |
>RC213768 representing NM_004503
Red=Cloning site Green=Tags(s) MNSYFTNPSLSCHLAGGQDVLPNVALNSTAYDPVRHFSTYGAAVAQNRIYSTPFYSPQENVVFSSSRGPY DYGSNSFYQEKDMLSNCRQNTLGHNTQTSIAQDFSSEQGRTAPQDQKASIQIYPWMQRMNSHSGVGYGAD RRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKESNLTSTLSGGG GGATADSLGGKEEKREETEEEKQKE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004494 |
RefSeq Size | 1681 |
RefSeq ORF | 705 |
Synonyms | CP25; HHO.C8; HOX3; HOX3C |
Locus ID | 3223 |
Cytogenetics | 12q13.13 |
Summary | This gene belongs to the homeobox family, members of which encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC6, is one of several HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5' non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Alternatively spliced transcript variants encoding different isoforms have been identified for HOXC6. Transcript variant two includes the shared exon, and transcript variant one includes only gene-specific exons. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401432 | HOXC6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC403515 | HOXC6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401432 | Transient overexpression lysate of homeobox C6 (HOXC6), transcript variant 1 |
CNY 3,080.00 |
|
LY403515 | Transient overexpression lysate of homeobox C6 (HOXC6), transcript variant 2 |
CNY 3,080.00 |
|
TP313768 | Recombinant protein of human homeobox C6 (HOXC6), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP761182 | Purified recombinant protein of Human homeobox C6 (HOXC6), transcript variant 2n, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |