TBL1 (TBL1X) (NM_005647) Human Mass Spec Standard
CAT#: PH313516
TBL1X MS Standard C13 and N15-labeled recombinant protein (NP_005638)
View other "TBL1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | TBL1X MS Standard C13 and N15-labeled recombinant protein (NP_005638) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC213516 |
Predicted MW | 62.3 kDa |
Protein Sequence |
>RC213516 representing NM_005647
Red=Cloning site Green=Tags(s) MTELAGASSSCCHRPAGRGAMQSVLHHFQRLRGREGGSHFINTSSPRGEAKMSITSDEVNFLVYRYLQES GFSHSAFTFGIESHISQSNINGTLVPPAALISILQKGLQYVEAEISINEDGTVFDGRPIESLSLIDAVMP DVVQTRQQAFREKLAQQQASAAAAAAAATAAATAATTTSAGVSHQNPSKNREATVNGEENRAHSVNNHAK PMEIDGEVEIPSSKATVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLNENSNGGSTQLVLRHCIRE GGHDVPSNKDVTSLDWNTNGTLLATGSYDGFARIWTEDGNLASTLGQHKGPIFALKWNRKGNYILSAGVD KTTIIWDAHTGEAKQQFPFHSAPALDVDWQNNTTFASCSTDMCIHVCRLGCDRPVKTFQGHTNEVNAIKW DPSGMLLASCSDDMTLKIWSMKQEVCIHDLQAHNKEIYTIKWSPTGPATSNPNSNIMLASASFDSTVRLW DIERGVCTHTLTKHQEPVYSVAFSPDGKYLASGSFDKCVHIWNTQSGNLVHSYRGTGGIFEVCWNARGDK VGASASDGSVCVLDLRK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005638 |
RefSeq Size | 5886 |
RefSeq ORF | 1731 |
Synonyms | CHNG8; EBI; SMAP55; TBL1 |
Locus ID | 6907 |
Cytogenetics | Xp22.31-p22.2 |
Summary | The protein encoded by this gene has sequence similarity with members of the WD40 repeat-containing protein family. The WD40 group is a large family of proteins, which appear to have a regulatory function. It is believed that the WD40 repeats mediate protein-protein interactions and members of the family are involved in signal transduction, RNA processing, gene regulation, vesicular trafficking, cytoskeletal assembly and may play a role in the control of cytotypic differentiation. This encoded protein is found as a subunit in corepressor SMRT (silencing mediator for retinoid and thyroid receptors) complex along with histone deacetylase 3 protein. This gene is located adjacent to the ocular albinism gene and it is thought to be involved in the pathogenesis of the ocular albinism with late-onset sensorineural deafness phenotype. Four transcript variants encoding two different isoforms have been found for this gene. This gene is highly similar to the Y chromosome TBL1Y gene. [provided by RefSeq, Nov 2008] |
Protein Families | Transcription Factors |
Protein Pathways | Wnt signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417178 | TBL1X HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC427964 | TBL1X HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417178 | Transient overexpression lysate of transducin (beta)-like 1X-linked (TBL1X), transcript variant 1 |
CNY 4,840.00 |
|
LY427964 | Transient overexpression lysate of transducin (beta)-like 1X-linked (TBL1X), transcript variant 2 |
CNY 3,080.00 |
|
TP313516 | Recombinant protein of human transducin (beta)-like 1X-linked (TBL1X), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP750166 | Purified recombinant protein of Human transducin (beta)-like 1X-linked (TBL1X), transcript variant 1, full length, Tag free, expressed in E.coli, 50ug |
CNY 1,948.00 |
|
TP760753 | Purified recombinant protein of Human transducin (beta)-like 1X-linked (TBL1X), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |