United States
Germany
Japan
United Kingdom
China
Carbonic anhydrase X (CA10) (NM_020178) Human Mass Spec Standard
CAT＃: PH313425
CA10 MS Standard C13 and N15-labeled recombinant protein (NP_064563)
View other "Carbonic anhydrase X" proteins (12)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | CA10 MS Standard C13 and N15-labeled recombinant protein (NP_064563) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC213425 |
| Predicted MW | 37.6 kDa |
| Protein Sequence |
>RC213425 protein sequence
Red=Cloning site Green=Tags(s) MEIVWEVLFLLQANFIVCISAQQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLCSVGKRQSPVN IETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDS QGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITY KNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFL SMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVNEWLLK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_064563 |
| RefSeq Size | 3260 |
| RefSeq ORF | 984 |
| Synonyms | CA-RPX; CARPX; HUCEP-15 |
| Locus ID | 56934 |
| Cytogenetics | 17q21.33-q22 |
| Summary | This gene encodes a protein that belongs to the carbonic anhydrase family of zinc metalloenzymes, which catalyze the reversible hydration of carbon dioxide in various biological processes. The protein encoded by this gene is an acatalytic member of the alpha-carbonic anhydrase subgroup, and it is thought to play a role in the central nervous system, especially in brain development. Multiple transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412601 | CA10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421186 | CA10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421187 | CA10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412601 | Transient overexpression lysate of carbonic anhydrase X (CA10), transcript variant 2 |
CNY 3,080.00 |
|
| LY421186 | Transient overexpression lysate of carbonic anhydrase X (CA10), transcript variant 1 |
CNY 3,080.00 |
|
| LY421187 | Transient overexpression lysate of carbonic anhydrase X (CA10), transcript variant 3 |
CNY 3,080.00 |
|
| PH309723 | CA10 MS Standard C13 and N15-labeled recombinant protein (NP_001076002) |
CNY 19,520.00 |
|
| PH312539 | CA10 MS Standard C13 and N15-labeled recombinant protein (NP_001076003) |
CNY 19,520.00 |
|
| TP309723 | Recombinant protein of human carbonic anhydrase X (CA10), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP312539 | Recombinant protein of human carbonic anhydrase X (CA10), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP313425 | Recombinant protein of human carbonic anhydrase X (CA10), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP720625 | Purified recombinant protein of Human carbonic anhydrase X (CA10), transcript variant 1 |
CNY 3,140.00 |
其它Carbonic anhydrase X产品
