LOX (NM_002317) Human Mass Spec Standard
CAT#: PH313323
LOX MS Standard C13 and N15-labeled recombinant protein (NP_002308)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | LOX MS Standard C13 and N15-labeled recombinant protein (NP_002308) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC213323 |
Predicted MW | 46.8 kDa |
Protein Sequence |
>RC213323 representing NM_002317
Red=Cloning site Green=Tags(s) MRFAWTVLLLGPLQLCALVHCAPPAAGQQQPPREPPAAPGAWRQQIQWENNGQVFSLLSLGSQYQPQRRR DPGAAVPGAANASAQQPRTPILLIRDNRTAAARTRTAGSSGVTAGRPRPTARHWFQAGYSTSRAREAGAS RAENQTAPGEVPALSNLRPPSRVDGMVGDDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQY GLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPS RPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPG CYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002308 |
RefSeq Size | 1946 |
RefSeq ORF | 1251 |
Synonyms | AAT10 |
Locus ID | 4015 |
Cytogenetics | 5q23.1 |
Summary | This gene encodes a member of the lysyl oxidase family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate a regulatory propeptide and the mature enzyme. The copper-dependent amine oxidase activity of this enzyme functions in the crosslinking of collagens and elastin, while the propeptide may play a role in tumor suppression. In addition, defects in this gene have been linked with predisposition to thoracic aortic aneurysms and dissections. [provided by RefSeq, Jul 2016] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400843 | LOX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400843 | Transient overexpression lysate of lysyl oxidase (LOX) |
CNY 3,080.00 |
|
TP313323 | Recombinant protein of human lysyl oxidase (LOX), 20 µg |
CNY 2,900.00 |
|
TP700002 | Recombinant protein of N-terminal propeptide (LOXPP) of human lysyl oxidase (LOX), with C-terminal DDK/His tag, expressed in human cells |
CNY 6,650.00 |
|
TP790154 | Purified recombinant protein of Human lysyl oxidase (LOX), with C-terminal DDK tag, secretory expressed in CHO cells, 20ug |
CNY 6,650.00 |