ALDH8A1 (NM_022568) Human Mass Spec Standard
CAT#: PH313029
ALDH8A1 MS Standard C13 and N15-labeled recombinant protein (NP_072090)
View other "ALDH8A1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ALDH8A1 MS Standard C13 and N15-labeled recombinant protein (NP_072090) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC213029 |
Predicted MW | 53.4 kDa |
Protein Sequence |
>RC213029 protein sequence
Red=Cloning site Green=Tags(s) MAGTNALLMLENFIDGKFLPCSSYIDSYDPSTGEVYCRVPNSGKDEIEAAVKAAREAFPSWSSRSPQERS RVLNQVADLLEQSLEEFAQAESKDQGKTLALARTMDIPRSVQNFRFFASSSLHHTSECTQMDHLGCMHYT VRAPVGVAGLISPWNLPLYLLTWKIAPAMAAGNTVIAKPSELTSVTAWMLCKLLDKAGVPPGVVNIVFGT GPRVGEALVSHPEVPLISFTGSQPTAERITQLSAPHCKKLSLELGGKNPAIIFEDANLDECIPATVRSSF ANQGEICLCTSRIFVQKSIYSEFLKRFVEATRKWKVGIPSDPLVSIGALISKAHLEKVRSYVKRALAEGA QIWCGEGVDKLSLPARNQAGYFMLPTVITDIKDESCCMTEEIFGPVTCVVPFDSEEEVIERANNVKYGLA ATVWSSNVGRVHRVAKKLQSGLVWTNCWLIRELNLPFGGMKSSGIGREGAKDSYDFFTEIKTITVKH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_072090 |
RefSeq Size | 2567 |
RefSeq ORF | 1461 |
Synonyms | ALDH12; DJ352A20.2 |
Locus ID | 64577 |
Cytogenetics | 6q23.3 |
Summary | This gene encodes a member of the aldehyde dehydrogenase family of proteins. The encoded protein has been implicated in the synthesis of 9-cis-retinoic acid and in the breakdown of the amino acid tryptophan. This enzyme converts 9-cis-retinal into the retinoid X receptor ligand 9-cis-retinoic acid, and has approximately 40-fold higher activity with 9-cis-retinal than with all-trans-retinal. In addition, this enzyme has been shown to catalyze the conversion of 2-aminomuconic semialdehyde to 2-aminomuconate in the kynurenine pathway of tryptophan catabolism. [provided by RefSeq, Jul 2018] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406874 | ALDH8A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC411634 | ALDH8A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC434230 | ALDH8A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406874 | Transient overexpression lysate of aldehyde dehydrogenase 8 family, member A1 (ALDH8A1), transcript variant 2 |
CNY 4,840.00 |
|
LY411634 | Transient overexpression lysate of aldehyde dehydrogenase 8 family, member A1 (ALDH8A1), transcript variant 1 |
CNY 4,840.00 |
|
LY434230 | Transient overexpression lysate of aldehyde dehydrogenase 8 family, member A1 (ALDH8A1), transcript variant 3 |
CNY 3,080.00 |
|
TP313029 | Recombinant protein of human aldehyde dehydrogenase 8 family, member A1 (ALDH8A1), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它ALDH8A1产品