DEGS1 (NM_003676) Human Mass Spec Standard
CAT#: PH312803
DEGS1 MS Standard C13 and N15-labeled recombinant protein (NP_003667)
View other "DEGS1" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | DEGS1 MS Standard C13 and N15-labeled recombinant protein (NP_003667) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212803 |
Predicted MW | 37.9 kDa |
Protein Sequence |
>RC212803 protein sequence
Red=Cloning site Green=Tags(s) MGSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMVLTQLGAFYIVKDLDWKWVI FGAYAFGSCINHSMTLAIHEIAHNAAFGNCKAMWNRWFGMFANLPIGIPYSISFKRYHMDHHRYLGADGV DVDIPTDFEGWFFCTAFRKFIWVILQPLFYAFRPLFINPKPITYLEVINTVAQVTFDILIYYFLGIKSLV YMLAASLLGLGLHPISGHFIAEHYMFLKGHETYSYYGPLNLLTFNVGYHNEHHDFPNIPGKSLPLVRKIA AEYYDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003667 |
RefSeq Size | 2101 |
RefSeq ORF | 969 |
Synonyms | DEGS; DEGS-1; Des-1; DES1; FADS7; HLD18; MIG15; MLD |
Locus ID | 8560 |
Cytogenetics | 1q42.11 |
Summary | This gene encodes a member of the membrane fatty acid desaturase family which is responsible for inserting double bonds into specific positions in fatty acids. This protein contains three His-containing consensus motifs that are characteristic of a group of membrane fatty acid desaturases. It is predicted to be a multiple membrane-spanning protein localized to the endoplasmic reticulum. Overexpression of this gene inhibited biosynthesis of the EGF receptor, suggesting a possible role of a fatty acid desaturase in regulating biosynthetic processing of the EGF receptor. [provided by RefSeq, Mar 2010] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Metabolic pathways, Sphingolipid metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408094 | DEGS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418506 | DEGS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408094 | Transient overexpression lysate of degenerative spermatocyte homolog 1, lipid desaturase (Drosophila) (DEGS1), transcript variant 2 |
CNY 3,080.00 |
|
LY418506 | Transient overexpression lysate of degenerative spermatocyte homolog 1, lipid desaturase (Drosophila) (DEGS1), transcript variant 1 |
CNY 3,080.00 |
|
TP312803 | Recombinant protein of human degenerative spermatocyte homolog 1, lipid desaturase (Drosophila) (DEGS1), transcript variant 1, 20 µg |
CNY 2,900.00 |