United States
Germany
Japan
United Kingdom
China
hnRNP F (HNRNPF) (NM_001098205) Human Mass Spec Standard
CAT＃: PH312612
HNRNPF MS Standard C13 and N15-labeled recombinant protein (NP_001091675)
View other "hnRNP F" proteins (25)
|
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Product images
CNY 1,999.00
CNY 2,700.00
热销推荐CNY 3,080.00
Specifications
| Product Data | |
| Description | HNRNPF MS Standard C13 and N15-labeled recombinant protein (NP_001091675) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC212612 |
| Predicted MW | 45.7 kDa |
| Protein Sequence |
>RC212612 representing NM_001098205
Red=Cloning site Green=Tags(s) MMLGPEGGEGFVVKLRGLPWSCSVEDVQNFLSDCTIHDGAAGVHFIYTREGRQSGEAFVELGSEDDVKMA LKKDRESMGHRYIEVFKSHRTEMDWVLKHSGPNSADSANDGFVRLRGLPFGCTKEEIVQFFSGLEIVPNG ITLPVDPEGKITGEAFVQFASQELAEKALGKHKERIGHRYIEVFKSSQEEVRSYSDPPLKFMSVQRPGPY DRPGTARRYIGIVKQAGLERMRPGAYSTGYGGYEEYSGLSDGYGFTTDLFGRDLSYCLSGMYDHRYGDSE FTVQSTTGHCVHMRGLPYKATENDIYNFFSPLNPVRVHIEIGPDGRVTGEADVEFATHEEAVAAMSKDRA NMQHRYIELFLNSTTGASNGAYSSQVMQGMGVSAAQATYSGLESQSVSGCYGAGYSGQNSMGGYD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001091675 |
| RefSeq Size | 2690 |
| RefSeq ORF | 1245 |
| Synonyms | HNRPF; mcs94-1; OK/SW-cl.23 |
| Locus ID | 3185 |
| Cytogenetics | 10q11.21 |
| Summary | This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins that complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and regulate alternative splicing, polyadenylation, and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has three repeats of quasi-RRM domains that bind to RNAs which have guanosine-rich sequences. This protein is very similar to the family member hnRPH. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401544 | HNRNPF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420552 | HNRNPF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420553 | HNRNPF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420554 | HNRNPF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420555 | HNRNPF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420556 | HNRNPF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426000 | HNRNPF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426004 | HNRNPF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401544 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein F (HNRNPF), transcript variant 3 |
CNY 3,080.00 |
|
| LY420552 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein F (HNRNPF), transcript variant 2 |
CNY 3,080.00 |
|
| LY420553 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein F (HNRNPF), transcript variant 4 |
CNY 3,080.00 |
|
| LY420554 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein F (HNRNPF), transcript variant 5 |
CNY 3,080.00 |
|
| LY420555 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein F (HNRNPF), transcript variant 6 |
CNY 3,080.00 |
|
| LY420556 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein F (HNRNPF), transcript variant 1 |
CNY 3,080.00 |
|
| LY426000 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein F (HNRNPF), transcript variant 2 |
CNY 3,080.00 |
|
| LY426004 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein F (HNRNPF), transcript variant 1 |
CNY 3,080.00 |
|
| PH305100 | HNRNPF MS Standard C13 and N15-labeled recombinant protein (NP_004957) |
CNY 19,520.00 |
|
| PH312850 | HNRNPF MS Standard C13 and N15-labeled recombinant protein (NP_001091674) |
CNY 14,250.00 |
|
| PH313874 | HNRNPF MS Standard C13 and N15-labeled recombinant protein (NP_001091677) |
CNY 14,250.00 |
|
| PH317995 | HNRNPF MS Standard C13 and N15-labeled recombinant protein (NP_001091676) |
CNY 14,250.00 |
|
| TP305100 | Recombinant protein of human heterogeneous nuclear ribonucleoprotein F (HNRNPF), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP312612 | Purified recombinant protein of Homo sapiens heterogeneous nuclear ribonucleoprotein F (HNRNPF), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
| TP312850 | Purified recombinant protein of Homo sapiens heterogeneous nuclear ribonucleoprotein F (HNRNPF), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP313874 | Purified recombinant protein of Homo sapiens heterogeneous nuclear ribonucleoprotein F (HNRNPF), transcript variant 6, 20 µg |
CNY 2,900.00 |
|
| TP317995 | Purified recombinant protein of Homo sapiens heterogeneous nuclear ribonucleoprotein F (HNRNPF), transcript variant 5, 20 µg |
CNY 2,900.00 |
其它hnRNP F产品
