IGF1 (NM_000618) Human Mass Spec Standard
CAT#: PH312527
IGF1 MS Standard C13 and N15-labeled recombinant protein (NP_000609)
View other "IGF1" proteins (10)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | IGF1 MS Standard C13 and N15-labeled recombinant protein (NP_000609) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212527 |
Predicted MW | 17.03 kDa |
Protein Sequence |
>RC212527 representing NM_000618
Red=Cloning site Green=Tags(s) MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRG FYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKEVHLKN ASRGSAGNKNYRM myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000609 |
RefSeq Size | 7260 |
RefSeq ORF | 459 |
Synonyms | IGF; IGF-I; IGFI; MGF |
Locus ID | 3479 |
Cytogenetics | 12q23.2 |
Summary | The protein encoded by this gene is similar to insulin in function and structure and is a member of a family of proteins involved in mediating growth and development. The encoded protein is processed from a precursor, bound by a specific receptor, and secreted. Defects in this gene are a cause of insulin-like growth factor I deficiency. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar processing to generate mature protein. [provided by RefSeq, Sep 2015] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein |
Protein Pathways | Dilated cardiomyopathy, Focal adhesion, Glioma, Hypertrophic cardiomyopathy (HCM), Long-term depression, Melanoma, mTOR signaling pathway, Oocyte meiosis, p53 signaling pathway, Pathways in cancer, Progesterone-mediated oocyte maturation, Prostate cancer |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400206 | IGF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC426358 | IGF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC426359 | IGF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY400206 | Transient overexpression lysate of insulin-like growth factor 1 (somatomedin C) (IGF1), transcript variant 4 |
CN¥ 3,080.00 |
|
LY426358 | Transient overexpression lysate of insulin-like growth factor 1 (somatomedin C) (IGF1), transcript variant 1 |
CN¥ 3,080.00 |
|
LY426359 | Transient overexpression lysate of insulin-like growth factor 1 (somatomedin C) (IGF1), transcript variant 2 |
CN¥ 3,080.00 |
|
TP312527 | Recombinant protein of human insulin-like growth factor 1 (somatomedin C) (IGF1), transcript variant 4, 20 µg |
CN¥ 2,900.00 |
|
TP720018 | Recombinant protein of human insulin-like growth factor 1 (somatomedin C) (IGF1), transcript variant 4 |
CN¥ 1,800.00 |
|
TP720023 | Recombinant protein of human insulin-like growth factor 1 (somatomedin C) (IGF1), transcript variant 4 |
CN¥ 1,800.00 |
|
TP721030 | Purified recombinant protein of Human insulin-like growth factor 1 (somatomedin C) (IGF1), transcript variant 4 |
CN¥ 1,800.00 |