Retinal protein 4 (UNC119) (NM_054035) Human Mass Spec Standard
CAT#: PH312513
UNC119 MS Standard C13 and N15-labeled recombinant protein (NP_473376)
View other "Retinal protein 4" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
CNY 3,080.00
Specifications
Product Data | |
Description | UNC119 MS Standard C13 and N15-labeled recombinant protein (NP_473376) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212513 |
Predicted MW | 23.9 kDa |
Protein Sequence |
>RC212513 representing NM_054035
Red=Cloning site Green=Tags(s) MKVKKGGGGAGTATESAPGPSGQSVAPIPQPPAESESGSESEPDAGPGPRPGPLQRKQPIGPEDVLGLQR ITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRL RQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELSARAGSS GSGEVGASRD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_473376 |
RefSeq Size | 1667 |
RefSeq ORF | 660 |
Synonyms | HRG4; IMD13; POC7; POC7A |
Locus ID | 9094 |
Cytogenetics | 17q11.2 |
Summary | This gene is specifically expressed in the photoreceptors in the retina. The encoded product shares strong homology with the C. elegans unc119 protein and it can functionally complement the C. elegans unc119 mutation. It has been localized to the photoreceptor synapses in the outer plexiform layer of the retina, and suggested to play a role in the mechanism of photoreceptor neurotransmitter release through the synaptic vesicle cycle. Two transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409279 | UNC119 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC417490 | UNC119 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409279 | Transient overexpression lysate of unc-119 homolog (C. elegans) (UNC119), transcript variant 2 |
CNY 3,080.00 |
|
LY417490 | Transient overexpression lysate of unc-119 homolog (C. elegans) (UNC119), transcript variant 1 |
CNY 3,080.00 |
|
PH303758 | UNC119 MS Standard C13 and N15-labeled recombinant protein (NP_005139) |
CNY 19,520.00 |
|
TP303758 | Recombinant protein of human unc-119 homolog (C. elegans) (UNC119), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP312513 | Purified recombinant protein of Homo sapiens unc-119 homolog (C. elegans) (UNC119), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它Retinal protein 4产品