PID1 (NM_001100818) Human Mass Spec Standard
CAT#: PH312505
PID1 MS Standard C13 and N15-labeled recombinant protein (NP_001094288)
View other "PID1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | PID1 MS Standard C13 and N15-labeled recombinant protein (NP_001094288) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212505 |
Predicted MW | 24.6 kDa |
Protein Sequence |
>RC212505 representing NM_001100818
Red=Cloning site Green=Tags(s) MWQPATERLQHFQTMLKSKLNVLTLKKEPLPAVIFHEPEAIELCTTTPLMKTRTHSGCKVTYLGKVSTTG MQFLSGCTEKPVIELWKKHTLAREDVFPANALLEIRPFQVWLHHLDHKGEATVHMDTFQVARIAYCTADH NVSPNIFAWVYREINDDLSYQMDCHAVECESKLEAKKLAHAMMEAFRKTFHSMKSDGRIHSNSSSEEVSQ ELESDDG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001094288 |
RefSeq Size | 2626 |
RefSeq ORF | 651 |
Synonyms | HMFN2073; NYGGF4; P-CLI1; PCLI1 |
Locus ID | 55022 |
Cytogenetics | 2q36.3 |
Summary | Increases proliferation of preadipocytes without affecting adipocytic differentiation.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402631 | PID1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420294 | PID1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402631 | Transient overexpression lysate of phosphotyrosine interaction domain containing 1 (PID1), transcript variant 1 |
CNY 3,080.00 |
|
LY420294 | Transient overexpression lysate of phosphotyrosine interaction domain containing 1 (PID1), transcript variant 2 |
CNY 3,080.00 |
|
PH312451 | PID1 MS Standard C13 and N15-labeled recombinant protein (NP_060403) |
CNY 19,520.00 |
|
TP312451 | Recombinant protein of human phosphotyrosine interaction domain containing 1 (PID1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP312505 | Purified recombinant protein of Homo sapiens phosphotyrosine interaction domain containing 1 (PID1), transcript variant 2, 20 µg |
CNY 2,900.00 |