PPAR gamma (PPARG) (NM_005037) Human Mass Spec Standard
CAT#: PH312449
PPARG MS Standard C13 and N15-labeled recombinant protein (NP_005028)
View other "PPAR gamma" proteins (17)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | PPARG MS Standard C13 and N15-labeled recombinant protein (NP_005028) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212449 |
Predicted MW | 54.7 kDa |
Protein Sequence |
>RC212449 protein sequence
Red=Cloning site Green=Tags(s) MTMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLK LQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIR LKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESAD LRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIR IFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTR EFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQ LKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005028 |
RefSeq Size | 1818 |
RefSeq ORF | 1431 |
Synonyms | CIMT1; GLM1; NR1C3; PPARG1; PPARG2; PPARG5; PPARgamma |
Locus ID | 5468 |
Cytogenetics | 3p25.2 |
Summary | This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) subfamily of nuclear receptors. PPARs form heterodimers with retinoid X receptors (RXRs) and these heterodimers regulate transcription of various genes. Three subtypes of PPARs are known: PPAR-alpha, PPAR-delta, and PPAR-gamma. The protein encoded by this gene is PPAR-gamma and is a regulator of adipocyte differentiation. Additionally, PPAR-gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer. Alternatively spliced transcript variants that encode different isoforms have been described. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Protein Pathways | Huntington's disease, Pathways in cancer, PPAR signaling pathway, Thyroid cancer |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402467 | PPARG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC408558 | PPARG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC408559 | PPARG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC417568 | PPARG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC430063 | PPARG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402467 | Transient overexpression lysate of peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 2 |
CNY 4,840.00 |
|
LY408558 | Transient overexpression lysate of peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 3 |
CNY 3,080.00 |
|
LY408559 | Transient overexpression lysate of peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 1 |
CNY 3,080.00 |
|
LY417568 | Transient overexpression lysate of peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 4 |
CNY 3,080.00 |
|
LY430063 | Transient overexpression lysate of peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 1 |
CNY 3,080.00 |
|
PH301538 | PPARG MS Standard C13 and N15-labeled recombinant protein (NP_619726) |
CNY 19,520.00 |
|
PH312181 | PPARG MS Standard C13 and N15-labeled recombinant protein (NP_619725) |
CNY 19,520.00 |
|
PH312502 | PPARG MS Standard C13 and N15-labeled recombinant protein (NP_056953) |
CNY 19,520.00 |
|
TP301538 | Recombinant protein of human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP312181 | Recombinant protein of human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP312449 | Recombinant protein of human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
TP312502 | Recombinant protein of human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它PPAR gamma产品