RFX5 (NM_001025603) Human Mass Spec Standard
CAT#: PH312448
RFX5 MS Standard C13 and N15-labeled recombinant protein (NP_001020774)
View other "RFX5" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RFX5 MS Standard C13 and N15-labeled recombinant protein (NP_001020774) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212448 |
Predicted MW | 65.1 kDa |
Protein Sequence |
>RC212448 representing NM_001025603
Red=Cloning site Green=Tags(s) MAEDEPDAKSPKTGGRAPPGGAEAGEPTTLLQRLRGTISKAVQNKVEGILQDVQKFSDNDKLYLYLQLPS GPTTGDKSSEPSTLSNEEYMYAYRWIRNHLEEHTDTCLPKQSVYDAYRKYCESLACCRPLSTANFGKIIR EIFPDIKARRLGGRGQSKYCYSGIRRKTLVSMPPLPGLDLKGSESPEMGPEVTPAPRDELVEAACALTCD WAERILKRSFSSIVEVARFLLQQHLISARSAHAHVLKAMGLAEEDEHAPRERSSKPKNGLENPEGGAHKK PERLAQPPKDLEARTGAGPLARGERKKSVVESSAPGANNLQVNALVARLPLLLPRAPRSLIPPIPVSPPI LAPRLSSGALKVATLPLSSRAGAPPAAVPIINMILPTVPALPGPGPGPGRAPPGGLTQPRGTENREVGIG GDQGPHDKGVKRTAEVPVSEASGQAPPAKAAKQDIEDTASDAKRKRGRPRKKSGGSGERNSTPLKSAAAM ESAQSSRLPWETWGSGGEGNSAGGAERPGPMGEAEKGAVLAQGQGDGTVSKGGRGPGSQHTKEAEDKIPL VPSKVSVIKGSRSQKEAFPLAKGEVDTAPQGNKDLKEHVLQSSLSQEHKDPKATPP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001020774 |
RefSeq Size | 3611 |
RefSeq ORF | 1848 |
Locus ID | 5993 |
Cytogenetics | 1q21.3 |
Summary | A lack of MHC-II expression results in a severe immunodeficiency syndrome called MHC-II deficiency, or the bare lymphocyte syndrome (BLS; MIM 209920). At least 4 complementation groups have been identified in B-cell lines established from patients with BLS. The molecular defects in complementation groups B, C, and D all lead to a deficiency in RFX, a nuclear protein complex that binds to the X box of MHC-II promoters. The lack of RFX binding activity in complementation group C results from mutations in the RFX5 gene encoding the 75-kD subunit of RFX (Steimle et al., 1995). RFX5 is the fifth member of the growing family of DNA-binding proteins sharing a novel and highly characteristic DNA-binding domain called the RFX motif. Multiple alternatively spliced transcript variants have been found but the full-length natures of only two have been determined. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Protein Pathways | Antigen processing and presentation, Primary immunodeficiency |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422455 | RFX5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC424713 | RFX5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY422455 | Transient overexpression lysate of regulatory factor X, 5 (influences HLA class II expression) (RFX5), transcript variant 2 |
CNY 4,840.00 |
|
LY424713 | Transient overexpression lysate of regulatory factor X, 5 (influences HLA class II expression) (RFX5), transcript variant 1 |
CNY 3,080.00 |
|
TP312448 | Recombinant protein of human regulatory factor X, 5 (influences HLA class II expression) (RFX5), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP761917 | Purified recombinant protein of Human regulatory factor X, 5 (influences HLA class II expression) (RFX5), transcript variant 1, Leu391-Pro616, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |