BMP6 (NM_001718) Human Mass Spec Standard
CAT#: PH312307
BMP6 MS Standard C13 and N15-labeled recombinant protein (NP_001709)
View other "BMP6" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | BMP6 MS Standard C13 and N15-labeled recombinant protein (NP_001709) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212307 |
Predicted MW | 57 kDa |
Protein Sequence |
>RC212307 representing NM_001718
Red=Cloning site Green=Tags(s) MPGLGRRAQWLCWWWGLLCSCCGPPPLRPPLPAAAAAAAGGQLLGDGGSPGRTEQPPPSPQSSSGFLYRR LKTQEKREMQKEILSVLGLPHRPRPLHGLQQPQPPALRQQEEQQQQQQLPRGEPPPGRLKSAPLFMLDLY NALSADNDEDGASEGERQQSWPHEAASSSQRRQPPPGAAHPLNRKSLLAPGSGSGGASPLTSAQDSAFLN DADMVMSFVNLVEYDKEFSPRQRHHKEFKFNLSQIPEGEVVTAAEFRIYKDCVMGSFKNQTFLISIYQVL QEHQHRDSDLFLLDTRVVWASEEGWLEFDITATSNLWVVTPQHNMGLQLSVVTRDGVHVHPRAAGLVGRD GPYDKQPFMVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELYVS FQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLY FDDNSNVILKKYRNMVVRACGCH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001709 |
RefSeq Size | 2943 |
RefSeq ORF | 1539 |
Synonyms | VGR; VGR1 |
Locus ID | 654 |
Cytogenetics | 6p24.3 |
Summary | This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein regulates a wide range of biological processes including iron homeostasis, fat and bone development, and ovulation. Differential expression of this gene may be associated with progression of breast and prostate cancer. Mutations in this gene may be associated with iron overload in human patients. [provided by RefSeq, Jul 2016] |
Protein Families | Adult stem cells, Cancer stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Secreted Protein, Stem cell relevant signaling - TGFb/BMP signaling pathway |
Protein Pathways | Hedgehog signaling pathway, TGF-beta signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400646 | BMP6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY400646 | Transient overexpression lysate of bone morphogenetic protein 6 (BMP6) |
CNY 4,840.00 |
|
TP312307 | Purified recombinant protein of Homo sapiens bone morphogenetic protein 6 (BMP6), 20 µg |
CNY 2,900.00 |