NOLA1 (GAR1) (NM_032993) Human Mass Spec Standard
CAT#: PH312074
GAR1 MS Standard C13 and N15-labeled recombinant protein (NP_127460)
View other "NOLA1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | GAR1 MS Standard C13 and N15-labeled recombinant protein (NP_127460) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212074 |
Predicted MW | 22.3 kDa |
Protein Sequence |
>RC212074 protein sequence
Red=Cloning site Green=Tags(s) MSFRGGGRGGFNRGGGGGGFNRGGSSNHFRGGGGGGGGGNFRGGGRGGFGRGGGRGGFNKGQDQGPPERV VLLGEFLHPCEDDIVCKCTTDENKVPYFNAPVYLENKEQIGKVDEIFGQLRDFYFSVKLSENMKASSFKK LQKFYIDPYKLLPLQRFLPRPPGEKGPPRGGGRGGRGGGRGGGGRGGGRGGGFRGGRGGGGGGFRGGRGG GFRGRGH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_127460 |
RefSeq Size | 1021 |
RefSeq ORF | 651 |
Synonyms | NOLA1 |
Locus ID | 54433 |
Cytogenetics | 4q25 |
Summary | This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also include the DKC1, NOLA2 and NOLA3 proteins. These four H/ACA snoRNP proteins localize to the dense fibrillar components of nucleoli and to coiled (Cajal) bodies in the nucleus. Both 18S rRNA production and rRNA pseudouridylation are impaired if any one of the four proteins is depleted. These four H/ACA snoRNP proteins are also components of the telomerase complex. The encoded protein of this gene contains two glycine- and arginine-rich domains and is related to Saccharomyces cerevisiae Gar1p. Two splice variants have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Stem cell - Pluripotency |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409794 | GAR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC412825 | GAR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409794 | Transient overexpression lysate of GAR1 ribonucleoprotein homolog (yeast) (GAR1), transcript variant 2 |
CNY 3,080.00 |
|
LY412825 | Transient overexpression lysate of GAR1 ribonucleoprotein homolog (yeast) (GAR1), transcript variant 1 |
CNY 3,080.00 |
|
PH301481 | GAR1 MS Standard C13 and N15-labeled recombinant protein (NP_061856) |
CNY 19,520.00 |
|
TP301481 | Recombinant protein of human GAR1 ribonucleoprotein homolog (yeast) (GAR1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP312074 | Recombinant protein of human GAR1 ribonucleoprotein homolog (yeast) (GAR1), transcript variant 2, 20 µg |
CNY 2,900.00 |