PAX2 (NM_003987) Human Mass Spec Standard
CAT#: PH312051
PAX2 MS Standard C13 and N15-labeled recombinant protein (NP_003978)
View other "PAX2" proteins (19)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | PAX2 MS Standard C13 and N15-labeled recombinant protein (NP_003978) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212051 |
Predicted MW | 44.5 kDa |
Protein Sequence |
>RC212051 representing NM_003987
Red=Cloning site Green=Tags(s) MDMHCKADPFSAMHPGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILG RYYETGSIKPGVIGGSKPKVATPKVVDKIAEYKRQNPTMFAWEIRDRLLAEGICDNDTVPSVSSINRIIR TKVQQPFHPTPDGAGTGVTAPGHTIVPSTASPPVSSASNDPVGSYSINGILGIPRSNGEKRKRDEVEVYT DPAHIRGGGGLHLVWTLRDVSEGSVPNGDSQSGVDSLRKHLRADTFTQQQLEALDRVFERPSYPDVFQAS EHIKSEQGNEYSLPALTPGLDEVKSSLSASTNPELGSNVSGTQTYPVVTGRDMASTTLPGYPPHVPPTGQ GSYPTSTLAGMVPGSEFSGNPYSHPQYTAYNEAWRFSNPALLSSPYYYSAAPRSAPAAAAAAYDRH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003978 |
RefSeq Size | 4276 |
RefSeq ORF | 1248 |
Synonyms | FSGS7; PAPRS |
Locus ID | 5076 |
Cytogenetics | 10q24.31 |
Summary | PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor suppressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Dec 2014] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400106 | PAX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418300 | PAX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC418301 | PAX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418302 | PAX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418303 | PAX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC429172 | PAX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400106 | Transient overexpression lysate of paired box 2 (PAX2), transcript variant b |
CNY 3,080.00 |
|
LY418300 | Transient overexpression lysate of paired box 2 (PAX2), transcript variant a |
CNY 4,840.00 |
|
LY418301 | Transient overexpression lysate of paired box 2 (PAX2), transcript variant c |
CNY 3,080.00 |
|
LY418302 | Transient overexpression lysate of paired box 2 (PAX2), transcript variant d |
CNY 3,080.00 |
|
LY418303 | Transient overexpression lysate of paired box 2 (PAX2), transcript variant e |
CNY 4,840.00 |
|
LY429172 | Transient overexpression lysate of paired box 2 (PAX2), transcript variant a |
CNY 3,080.00 |
|
PH312112 | PAX2 MS Standard C13 and N15-labeled recombinant protein (NP_000269) |
CNY 19,520.00 |
|
PH318386 | PAX2 MS Standard C13 and N15-labeled recombinant protein (NP_003979) |
CNY 19,520.00 |
|
TP312051 | Recombinant protein of human paired box 2 (PAX2), transcript variant a, 20 µg |
CNY 2,900.00 |
|
TP312112 | Recombinant protein of human paired box 2 (PAX2), transcript variant b, 20 µg |
CNY 2,900.00 |
|
TP318386 | Recombinant protein of human paired box 2 (PAX2), transcript variant c, 20 µg |
CNY 2,900.00 |
|
TP750191 | Purified recombinant protein of Human paired box 2 (PAX2), transcript variant a, Phe147-Val235, tag free, expressed in E.coli, 50ug |
CNY 2,840.00 |
|
TP762411 | Purified recombinant protein of Human paired box 2 (PAX2), transcript variant a, Arg266-End, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1,950.00 |