ASAH3 (ACER1) (NM_133492) Human Mass Spec Standard
CAT#: PH311332
ACER1 MS Standard C13 and N15-labeled recombinant protein (NP_597999)
View other "ASAH3" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ACER1 MS Standard C13 and N15-labeled recombinant protein (NP_597999) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211332 |
Predicted MW | 31.1 kDa |
Protein Sequence |
>RC211332 protein sequence
Red=Cloning site Green=Tags(s) MPSIFAYQSSEVDWCESNFQYSELVAEFYNTFSNIPFFIFGPLMMLLMHPYAQKRSRYIYVVWVLFMIIG LFSMYFHMTLSFLGQLLDEIAILWLLGSGYSIWMPRCYFPSFLGGNRSQFIRLVFITTVVSTLLSFLRPT VNAYALNSIALHILYIVCQEYRKTSNKELRHLIEVSVVLWAVALTSWISDRLLCSFWQRIHFFYLHSIWH VLISITFPYGMVTMALVDANYEMPGETLKVRYWPRDSWPVGLPYVEIRGDDKDC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_597999 |
RefSeq Size | 1088 |
RefSeq ORF | 792 |
Synonyms | ALKCDase1; ASAH3 |
Locus ID | 125981 |
Cytogenetics | 19p13.3 |
Summary | Ceramides are synthesized during epidermal differentiation and accumulate within the interstices of the stratum corneum, where they represent critical components of the epidermal permeability barrier. Excess cellular ceramide can trigger antimitogenic signals and induce apoptosis, and the ceramide metabolites sphingosine and sphingosine-1-phosphate (S1P) are important bioregulatory molecules. Ceramide hydrolysis in the nucleated cell layers regulates keratinocyte proliferation and apoptosis in response to external stress. Ceramide hydrolysis also occurs at the stratum corneum, releasing free sphingoid base that functions as an endogenous antimicrobial agent. ACER1 is highly expressed in epidermis and catalyzes the hydrolysis of very long chain ceramides to generate sphingosine (Houben et al., 2006 [PubMed 16477081]; Sun et al., 2008 [PubMed 17713573]).[supplied by OMIM, Jul 2010] |
Protein Families | Transmembrane |
Protein Pathways | Metabolic pathways, Sphingolipid metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408822 | ACER1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408822 | Transient overexpression lysate of alkaline ceramidase 1 (ACER1) |
CNY 3,080.00 |
|
TP311332 | Recombinant protein of human alkaline ceramidase 1 (ACER1), 20 µg |
CNY 2,900.00 |