PGK1 (NM_000291) Human Mass Spec Standard
CAT#: PH311172
PGK1 MS Standard C13 and N15-labeled recombinant protein (NP_000282)
View other "PGK1" proteins (4)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | PGK1 MS Standard C13 and N15-labeled recombinant protein (NP_000282) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211172 |
Predicted MW | 44.6 kDa |
Protein Sequence |
>RC211172 protein sequence
Red=Cloning site Green=Tags(s) MSLSNKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKSVVLMSHLGRPDGV PMPDKYSLEPVAVELKSLLGKDVLFLKDCVGPEVEKACANPAAGSVILLENLRFHVEEEGKGKDASGNKV KAEPAKIEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVNLPQKAGGFLMKKELNYFAKALESPERPFLA ILGGAKVADKIQLINNMLDKVNEMIIGGGMAFTFLKVLNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKI TLPVDFVTADKFDENAKTGQATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFAR GTKALMDEVVKATSRGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKVLPGVDALSNI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000282 |
RefSeq Size | 2439 |
RefSeq ORF | 1251 |
Synonyms | HEL-S-68p; MIG10; PGKA |
Locus ID | 5230 |
Cytogenetics | Xq21.1 |
Summary | The protein encoded by this gene is a glycolytic enzyme that catalyzes the conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate. The encoded protein may also act as a cofactor for polymerase alpha. Additionally, this protein is secreted by tumor cells where it participates in angiogenesis by functioning to reduce disulfide bonds in the serine protease, plasmin, which consequently leads to the release of the tumor blood vessel inhibitor angiostatin. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Deficiency of the enzyme is associated with a wide range of clinical phenotypes hemolytic anemia and neurological impairment. Pseudogenes of this gene have been defined on chromosomes 19, 21 and the X chromosome. [provided by RefSeq, Jan 2014] |
Protein Families | Druggable Genome |
Protein Pathways | Glycolysis / Gluconeogenesis, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400114 | PGK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY400114 | Transient overexpression lysate of phosphoglycerate kinase 1 (PGK1) |
CN¥ 3,080.00 |
|
TP311172 | Recombinant protein of human phosphoglycerate kinase 1 (PGK1), 20 µg |
CN¥ 2,900.00 |
|
TP721237 | Purified recombinant protein of Human phosphoglycerate kinase 1 (PGK1) |
CN¥ 1,800.00 |