Interferon alpha 8 (IFNA8) (NM_002170) Human Mass Spec Standard
CAT#: PH311169
IFNA8 MS Standard C13 and N15-labeled recombinant protein (NP_002161)
View other "Interferon alpha 8" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | IFNA8 MS Standard C13 and N15-labeled recombinant protein (NP_002161) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211169 |
Predicted MW | 22 kDa |
Protein Sequence |
>RC211169 protein sequence
Red=Cloning site Green=Tags(s) MALTFYLLVALVVLSYKSFSSLGCDLPQTHSLGNRRALILLAQMRRISPFSCLKDRHDFEFPQEEFDDKQ FQKAQAISVLHEMIQQTFNLFSTKDSSAALDETLLDEFYIELDQQLNDLESCVMQEVGVIESPLMYEDSI LAVRKYFQRITLYLTEKKYSSCAWEVVRAEIMRSFSLSINLQKRLKSKE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002161 |
RefSeq Size | 1039 |
RefSeq ORF | 567 |
Synonyms | IFN-alphaB |
Locus ID | 3445 |
Cytogenetics | 9p21.3 |
Summary | Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Antigen processing and presentation, Autoimmune thyroid disease, Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, Jak-STAT signaling pathway, Natural killer cell mediated cytotoxicity, Regulation of autophagy, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419487 | IFNA8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419487 | Transient overexpression lysate of interferon, alpha 8 (IFNA8) |
CNY 3,080.00 |
|
TP311169 | Recombinant protein of human interferon, alpha 8 (IFNA8), 20 µg |
CNY 2,900.00 |
其它Interferon alpha 8产品