Tuberoinfundibular peptide (PTH2) (NM_178449) Human Mass Spec Standard
CAT#: PH310906
PTH2 MS Standard C13 and N15-labeled recombinant protein (NP_848544)
View other "Tuberoinfundibular peptide" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | PTH2 MS Standard C13 and N15-labeled recombinant protein (NP_848544) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210906 |
Predicted MW | 11.2 kDa |
Protein Sequence |
>RC210906 protein sequence
Red=Cloning site Green=Tags(s) METRQVSRSPRVRLLLLLLLLLVVPWGVRTASGVALPPVGVLSLRPPGRAWADPATPRPRRSLALADDAA FRERARLLAALERRHWLNSYMHKLLVLDAP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_848544 |
RefSeq Size | 459 |
RefSeq ORF | 300 |
Synonyms | TIP39 |
Locus ID | 113091 |
Cytogenetics | 19q13.33 |
Summary | This gene encodes the precursor of a peptide hormone that shares sequence similarity with the parathyroid hormone. This gene is expressed in various regions of the brain where it plays a role in the release of pituitary hormones, anxiety and nociception. The encoded precursor protein is proteolytically processed to generate the biologically active neuropeptide. [provided by RefSeq, Jul 2015] |
Protein Families | Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403603 | PTH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403603 | Transient overexpression lysate of parathyroid hormone 2 (PTH2) |
CNY 3,080.00 |
|
TP310906 | Recombinant protein of human parathyroid hormone 2 (PTH2), 20 µg |
CNY 2,900.00 |
其它Tuberoinfundibular peptide产品