ETFB (NM_001985) Human Mass Spec Standard
CAT#: PH310894
ETFB MS Standard C13 and N15-labeled recombinant protein (NP_001976)
View other "ETFB" proteins (5)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | ETFB MS Standard C13 and N15-labeled recombinant protein (NP_001976) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210894 |
Predicted MW | 27.8 kDa |
Protein Sequence |
>RC210894 protein sequence
Red=Cloning site Green=Tags(s) MAELRVLVAVKRVIDYAVKIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIAVSCGPAQ CQETIRTALAMGADRGIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAG FLDWPQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVIK PGDLGVDLTSKLSVISVEDPPQRTAGVKVETTEDLVAKLKEIGRI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001976 |
RefSeq Size | 933 |
RefSeq ORF | 765 |
Synonyms | FP585; MADD |
Locus ID | 2109 |
Cytogenetics | 19q13.41 |
Summary | This gene encodes electron-transfer-flavoprotein, beta polypeptide, which shuttles electrons between primary flavoprotein dehydrogenases involved in mitochondrial fatty acid and amino acid catabolism and the membrane-bound electron transfer flavoprotein ubiquinone oxidoreductase. The gene deficiencies have been implicated in type II glutaricaciduria. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419607 | ETFB HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC423075 | ETFB HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY419607 | Transient overexpression lysate of electron-transfer-flavoprotein, beta polypeptide (ETFB), transcript variant 1 |
CN¥ 3,080.00 |
|
LY423075 | Transient overexpression lysate of electron-transfer-flavoprotein, beta polypeptide (ETFB), transcript variant 2 |
CN¥ 3,080.00 |
|
TP310894 | Recombinant protein of human electron-transfer-flavoprotein, beta polypeptide (ETFB), transcript variant 1, 20 µg |
CN¥ 2,900.00 |