CD200R (CD200R1) (NM_170780) Human Mass Spec Standard
CAT#: PH310870
CD200R1 MS Standard C13 and N15-labeled recombinant protein (NP_740750)
View other "CD200R" proteins (8)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | CD200R1 MS Standard C13 and N15-labeled recombinant protein (NP_740750) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210870 |
Predicted MW | 36.6 kDa |
Protein Sequence |
>RC210870 protein sequence
Red=Cloning site Green=Tags(s) MLCPWRTANLGLLLILTIFLVAASSSLCMDEKQITQNYSKVLAEVNTSWPVKMATNAVLCCPPIALRNLI IITWEIILRGQPSCTKAYKKETNETKETNCTDERITWVSRPDQNSDLQIRTVAITHDGYYRCIMVTPDGN FHRGYHLQVLVTPEVTLFQNRNRTAVCKAVAGKPAAHISWIPEGDCATKQEYWSNGTVTVKSTCHWEVHN VSTVTCHVSHLTGNKSLYIELLPVPGAKKSAKLYIPYIILTIIILTIVGFIWLLKVNGCRKYKLNKTEST PVVEEDEMQPYASYTEKNNPLYDTTNKVKASEALQSEVDTDLHTL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_740750 |
RefSeq Size | 2203 |
RefSeq ORF | 975 |
Synonyms | CD200R; HCRTR2; MOX2R; OX2R |
Locus ID | 131450 |
Cytogenetics | 3q13.2 |
Summary | This gene encodes a receptor for the OX-2 membrane glycoprotein. Both the receptor and substrate are cell surface glycoproteins containing two immunoglobulin-like domains. This receptor is restricted to the surfaces of myeloid lineage cells and the receptor-substrate interaction may function as a myeloid downregulatory signal. Mouse studies of a related gene suggest that this interaction may control myeloid function in a tissue-specific manner. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406878 | CD200R1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC408492 | CD200R1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY406878 | Transient overexpression lysate of CD200 receptor 1 (CD200R1), transcript variant 4 |
CN¥ 3,080.00 |
|
LY408492 | Transient overexpression lysate of CD200 receptor 1 (CD200R1), transcript variant 1 |
CN¥ 3,080.00 |
|
PH310223 | CD200R1 MS Standard C13 and N15-labeled recombinant protein (NP_620161) |
CN¥ 19,520.00 |
|
TP310223 | Recombinant protein of human CD200 receptor 1 (CD200R1), transcript variant 1, 20 µg |
CN¥ 2,900.00 |
|
TP310870 | Recombinant protein of human CD200 receptor 1 (CD200R1), transcript variant 4, 20 µg |
CN¥ 2,900.00 |
|
TP720280 | Recombinant protein of human CD200 receptor 1 (CD200R1), transcript variant 1 |
CN¥ 3,140.00 |