Nucleoside phosphorylase (PNP) (NM_000270) Human Mass Spec Standard
CAT#: PH310759
PNP MS Standard C13 and N15-labeled recombinant protein (NP_000261)
View other "Nucleoside phosphorylase" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | PNP MS Standard C13 and N15-labeled recombinant protein (NP_000261) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210759 |
Predicted MW | 32.1 kDa |
Protein Sequence |
>RC210759 protein sequence
Red=Cloning site Green=Tags(s) MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVF GFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPG FSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQ KLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMA SIPLPDKAS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000261 |
RefSeq Size | 2438 |
RefSeq ORF | 867 |
Synonyms | NP; PRO1837; PUNP |
Locus ID | 4860 |
Cytogenetics | 14q11.2 |
Summary | This gene encodes an enzyme which reversibly catalyzes the phosphorolysis of purine nucleosides. The enzyme is trimeric, containing three identical subunits. Mutations which result in nucleoside phosphorylase deficiency result in defective T-cell (cell-mediated) immunity but can also affect B-cell immunity and antibody responses. Neurologic disorders may also be apparent in patients with immune defects. A known polymorphism at aa position 51 that does not affect enzyme activity has been described. A pseudogene has been identified on chromosome 2. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Protein Pathways | Metabolic pathways, Nicotinate and nicotinamide metabolism, Purine metabolism, Pyrimidine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424829 | PNP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424829 | Transient overexpression lysate of purine nucleoside phosphorylase (PNP) |
CNY 3,080.00 |
|
TP310759 | Recombinant protein of human nucleoside phosphorylase (NP), 20 µg |
CNY 2,900.00 |
其它Nucleoside phosphorylase产品