TOMM20 (NM_014765) Human Mass Spec Standard
CAT#: PH310746
TOMM20 MS Standard C13 and N15-labeled recombinant protein (NP_055580)
View other "TOMM20" proteins (3)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | TOMM20 MS Standard C13 and N15-labeled recombinant protein (NP_055580) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210746 |
Predicted MW | 16.3 kDa |
Protein Sequence |
>RC210746 protein sequence
Red=Cloning site Green=Tags(s) MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFF LEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLA EDDVE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_055580 |
RefSeq Size | 3407 |
RefSeq ORF | 435 |
Synonyms | MAS20; MOM19; TOM20 |
Locus ID | 9804 |
Cytogenetics | 1q42.3 |
Summary | Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM22 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the TOM40 translocation pore (By similarity). Required for the translocation across the mitochondrial outer membrane of cytochrome P450 monooxygenases.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402378 | TOMM20 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY402378 | Transient overexpression lysate of translocase of outer mitochondrial membrane 20 homolog (yeast) (TOMM20), nuclear gene encoding mitochondrial protein |
CN¥ 3,080.00 |
|
TP310746 | Recombinant protein of human translocase of outer mitochondrial membrane 20 homolog (yeast) (TOMM20), nuclear gene encoding mitochondrial protein, 20 µg |
CN¥ 2,900.00 |