STEAP3 (NM_001008410) Human Mass Spec Standard
CAT#: PH310595
STEAP3 MS Standard C13 and N15-labeled recombinant protein (NP_001008410)
View other "STEAP3" proteins (10)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | STEAP3 MS Standard C13 and N15-labeled recombinant protein (NP_001008410) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210595 |
Predicted MW | 54.6 kDa |
Protein Sequence |
>RC210595 protein sequence
Red=Cloning site Green=Tags(s) MPEEMDKPLISLHLVDSDSSLAKVPDEAPKVGILGSGDFARSLATRLVGSGFKVVVGSRNPKRTARLFPS AAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNPTEQEHLQHRESNAEYLASLFPTC TVVKAFNVISAWTLQAGPRDGNRQVPICGDQPEAKRAVSEMALAMGFMPVDMGSLASAWEVEAMPLRLLP AWKVPTLLALGLFVCFYAYNFVRDVLQPYVQESQNKFFKLPVSVVNTTLPCVAYVLLSLVYLPGVLAAAL QLRRGTKYQRFPDWLDHWLQHRKQIGLLSFFCAALHALYSFCLPLRRAHRYDLVNLAVKQVLANKSHLWV EEEVWRMEIYLSLGVLALGTLSLLAVTSLPSIANSLNWREFSFVQSSLGFVALVLSTLHTLTYGWTRAFE ESRYKFYLPPTFTLTLLVPCVVILAKALFLLPCISRRLARIRRGWERESTIKFTLPTDHALAEKTSHV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001008410 |
RefSeq Size | 3870 |
RefSeq ORF | 1464 |
Synonyms | AHMIO2; dudlin-2; dudulin-2; pHyde; STMP3; TSAP6 |
Locus ID | 55240 |
Cytogenetics | 2q14.2 |
Summary | This gene encodes a multipass membrane protein that functions as an iron transporter. The encoded protein can reduce both iron (Fe3+) and copper (Cu2+) cations. This protein may mediate downstream responses to p53, including promoting apoptosis. Deficiency in this gene can cause anemia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2015] |
Protein Families | Transmembrane |
Protein Pathways | p53 signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405328 | STEAP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC413214 | STEAP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423432 | STEAP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC425238 | STEAP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405328 | Transient overexpression lysate of STEAP family member 3 (STEAP3), transcript variant 1 |
CNY 4,840.00 |
|
LY413214 | Transient overexpression lysate of STEAP family member 3 (STEAP3), transcript variant 2 |
CNY 3,080.00 |
|
LY423432 | Transient overexpression lysate of STEAP family member 3 (STEAP3), transcript variant 3 |
CNY 3,080.00 |
|
PH324274 | STEAP3 MS Standard C13 and N15-labeled recombinant protein (NP_060704) |
CNY 19,520.00 |
|
TP310595 | Recombinant protein of human STEAP family member 3 (STEAP3), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP324274 | Recombinant protein of human STEAP family member 3 (STEAP3), transcript variant 2, 20 µg |
CNY 2,900.00 |