United States
Germany
Japan
United Kingdom
China
PD1 (PDCD1) (NM_005018) Human Mass Spec Standard
CAT＃: PH310364
PD-1 / PDCD1 MS Standard C13 and N15-labeled recombinant protein (NP_005009)
View other "PD1" proteins (18)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 1,999.00
CNY 2,700.00
Specifications
| Product Data | |
| Description | PD-1 / PDCD1 MS Standard C13 and N15-labeled recombinant protein (NP_005009) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210364 |
| Predicted MW | 31.6 kDa |
| Protein Sequence |
>RC210364 protein sequence
Red=Cloning site Green=Tags(s) MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRM SPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRA ELRVTERRAEVPTAHPSPSPRPAGQFQTLVVGVVGGLLGSLVLLVWVLAVICSRAARGTIGARRTGQPLK EDPSAVPVFSVDYGELDFQWREKTPEPPVPCVPEQTEYATIVFPSGMGTSSPARRGSADGPRSAQPLRPE DGHCSWPL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005009 |
| RefSeq Size | 2115 |
| RefSeq ORF | 864 |
| Synonyms | CD279; hPD-1; hPD-l; hSLE1; PD-1; PD1; SLEB2 |
| Locus ID | 5133 |
| Cytogenetics | 2q37.3 |
| Summary | Programmed cell death protein 1 (PDCD1) is an immune-inhibitory receptor expressed in activated T cells; it is involved in the regulation of T-cell functions, including those of effector CD8+ T cells. In addition, this protein can also promote the differentiation of CD4+ T cells into T regulatory cells. PDCD1 is expressed in many types of tumors including melanomas, and has demonstrated to play a role in anti-tumor immunity. Moreover, this protein has been shown to be involved in safeguarding against autoimmunity, however, it can also contribute to the inhibition of effective anti-tumor and anti-microbial immunity. [provided by RefSeq, Aug 2020] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Cell adhesion molecules (CAMs), T cell receptor signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401555 | PDCD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401555 | Transient overexpression lysate of programmed cell death 1 (PD-1 / PDCD1) |
CNY 3,080.00 |
|
| TP310364 | Recombinant protein of human programmed cell death 1 (PDCD1), 20 µg |
CNY 2,900.00 |
|
| TP700198 | Purified recombinant protein of Homo sapiens programmed cell death 1 (PDCD1), 25-167aa, with C-terminal DDK/His tag, expressed in HEK293 cells. |
CNY 6,650.00 |
|
| TP700199 | Purified recombinant protein of Homo sapiens programmed cell death 1 (PD1/PDCD1), residues 25-167aa, with C-terminal Fc tag, expressed in HEK293 cells. |
CNY 6,650.00 |
|
| TP721292 | Human PD1 Protein (C-His) |
CNY 2,450.00 |
|
| TP721293 | Human PD1 Protein (C-His-Avi) |
CNY 2,450.00 |
|
| TP721294 | Biotinylated Human PD1 Protein (C-His-Avi) |
CNY 3,480.00 |
|
| TP721295 | PE Conjugated Human PD1 Protein (C-His) |
CNY 3,480.00 |
|
| TP721296 | APC Conjugated Human PD1 Protein (C-His) |
CNY 3,480.00 |
|
| TP721297 | Human PD1 Protein (C-Fc) |
CNY 2,450.00 |
|
| TP721298 | Human PD1 Protein (C-Fc-Avi) |
CNY 2,450.00 |
|
| TP721299 | Biotinylated Human PD1 Protein (C-Fc-Avi) |
CNY 3,480.00 |
|
| TP721300 | PE Conjugated Human PD1 Protein (C-Fc) |
CNY 3,480.00 |
|
| TP721301 | APC Conjugated Human PD1 Protein (C-Fc) |
CNY 3,480.00 |
|
| TP723948 | Human PD-1 Protein, mFc-His tag |
CNY 5,876.00 |
|
| TP723998 | Human PD-1 Protein, His tag |
CNY 4,925.00 |
|
| TP723999 | Human PD-1 Protein, hFc-His tag |
CNY 5,552.00 |
