NPTN (NM_017455) Human Mass Spec Standard
CAT#: PH310326
NPTN MS Standard C13 and N15-labeled recombinant protein (NP_059429)
View other "NPTN" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | NPTN MS Standard C13 and N15-labeled recombinant protein (NP_059429) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210326 |
Predicted MW | 31.3 kDa |
Protein Sequence |
>RC210326 protein sequence
Red=Cloning site Green=Tags(s) MSGSSLPSALALSLLLVSGSLLPGPGAAQNEPRIVTSEEVIIRDSPVLPVTLQCNLTSSSHTLTYSYWTK NGVELSATRKNASNMEYRINKPRAEDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKNEGQDAT MYCKSVGYPHPDWIWRKKENGMPMDIVNTSGRFFIINKENYTELNIVNLQITEDPGEYECNATNAIGSAS VVTVLRVRSHLAPLWPFLGILAEIIILVVIIVVYEKRKRPDEVPDDDEPAGPMKTNSTNNHKDKNLRQRN TN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_059429 |
RefSeq Size | 2106 |
RefSeq ORF | 846 |
Synonyms | GP55; GP65; np55; np65; SDFR1; SDR1 |
Locus ID | 27020 |
Cytogenetics | 15q24.1 |
Summary | This gene encodes a type I transmembrane protein belonging to the Ig superfamily. The protein is believed to be involved in cell-cell interactions or cell-substrate interactions. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2009] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413759 | NPTN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431237 | NPTN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431345 | NPTN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413759 | Transient overexpression lysate of neuroplastin (NPTN), transcript variant a |
CNY 3,080.00 |
|
LY431237 | Transient overexpression lysate of neuroplastin (NPTN), transcript variant d |
CNY 3,080.00 |
|
LY431345 | Transient overexpression lysate of neuroplastin (NPTN), transcript variant c |
CNY 3,080.00 |
|
TP310326 | Recombinant protein of human neuroplastin (NPTN), transcript variant alpha, 20 µg |
CNY 2,900.00 |
|
TP720412 | Recombinant protein of human neuroplastin (NPTN), transcript variant c. |
CNY 3,140.00 |